Beta-defensin 104

experimental

Also known as: Beta-defensin 4, Defensin, beta 104, DEFB104A, DEFB104B, Q8WTQ1

Beta-defensin 104 (DEFB104A/B) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif forming three disulfide bridges. Its primary mechanism of action involves disruption of microbial cell membranes through electrostatic interactions with negatively charged phospholipids, leading to membrane permeabilization and cell death. Additionally, it exhibits synergistic antimicrobial activity when combined with lysozyme and beta-defensin 103 (DEFB103), suggesting cooperative host defense mechanisms against bacterial pathogens. Current research on beta-defensin 104 remains at an experimental stage, with no published peer-reviewed studies indexed in PubMed. Available data are limited to genomic and proteomic annotations, indicating its expression in epithelial tissues and potential role in innate immunity. No functional assays or in vivo models have been reported, and its specific antimicrobial spectrum, regulation, or therapeutic potential remain uncharacterized. Given the absence of clinical studies, beta-defensin 104 has no established medical applications. Its experimental status precludes any conclusions regarding safety, efficacy, or dosing for human use. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Molecular weight
8526 g/mol
Research status
experimental
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, defensin, disulfide-bond, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103

Frequently asked questions

What is Beta-defensin 104?

Beta-defensin 104 (DEFB104A/B) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif forming three disulfide bridges. Its primary mechanism of action involves disruption of microbial cell membranes through electrostatic interactions with negatively charged ph

How does Beta-defensin 104 work?

Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103

What is the research status of Beta-defensin 104?

Beta-defensin 104 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 104?

Beta-defensin 104 has a molecular weight of approximately 8526 g/mol.

Related peptides

Build on Beta-defensin 104 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key