Antileukoproteinase

experimental

Also known as: BLPI, HUSI-1, Mucus proteinase inhibitor, Protease inhibitor WAP4, Secretory leukocyte protease inhibitor, Seminal proteinase inhibitor, WAP four-disulfide core domain protein 4, SLPI, P03973

Antileukoproteinase, also known as secretory leukocyte protease inhibitor (SLPI), is a 11.7 kDa serine protease inhibitor belonging to the WAP (whey acidic protein) four-disulfide core family. Its primary mechanism of action involves reversible, high-affinity inhibition of neutrophil-derived proteases such as elastase, cathepsin G, and trypsin, as well as chymotrypsin. The protein is acid-stable and secreted by mucosal epithelial cells, where it protects tissues from proteolytic damage during inflammation. Additionally, SLPI exhibits antimicrobial and anti-inflammatory properties, including inhibition of NF-κB activation and modulation of macrophage responses. Key research findings from 92 PubMed references indicate that SLPI plays a protective role in chronic inflammatory diseases, including cystic fibrosis, chronic obstructive pulmonary disease (COPD), and asthma, by neutralizing excessive protease activity. Studies also demonstrate its involvement in wound healing, where it promotes re-epithelialization, and in host defense against bacterial and viral infections, such as HIV-1 and influenza. Experimental models show that SLPI deficiency exacerbates inflammation and tissue damage, while exogenous administration reduces protease-mediated injury. Clinically, SLPI is being investigated as a potential therapeutic agent for inflammatory lung diseases, where aerosolized delivery could mitigate elastase-driven tissue destruction. Its dual anti-protease and anti-inflammatory actions make it a candidate for conditions with dysregulated protease activity. However, its experimental status limits current clinical application, and further research is needed to establish safety and efficacy in human trials. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Molecular weight
14326 g/mol
Research status
experimental
References
92
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, direct-protein-sequencing, disulfide-bond, immunity, innate-immunity, protease-inhibitor, proteomics-identification, reference-proteome, repeat

Mechanism of action

Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed:10702419, PubMed:2039600, PubMed:2110563, PubMed:24121345, PubMed:3462719, PubMed:3533531). Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS) (By similarity). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed:10702419, PubMed:24352879). Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (By similarity). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (PubMed:24352879)

Research & studies

From lactation to malignancy: A comparison between healthy and cancerous breast gland at single-cell resolution reveals new issues for tumorigenesis
FEBS letters · 2025 · PubMed
Neonatal and maternal upregulation of antileukoproteinase in horses
Frontiers in immunology · 2024 · PubMed

SLPI is constitutively secreted in equine tissues, with high concentrations in colostrum.; Neutrophils and a subset of CD14+ monocytes are SLPI-secreting immune cells in peripheral blood.; Serum SLPI peaks on the day of parturition in both mares and foals.; Foals maintain significantly elevated SLPI secretion until three months of age.

Candidate Molecular Compounds as Potential Indicators for Meibomian Gland Dysfunction
Frontiers in medicine · 2022 · PubMed
NOD2 signalling in hidradenitis suppurativa
Clinical and experimental dermatology · 2021 · PubMed
Gene expression in urinary incontinence and pelvic organ prolapse: a review of literature
Current opinion in obstetrics & gynecology · 2020 · PubMed
Gene expression in stress urinary incontinence: a systematic review
International urogynecology journal · 2020 · PubMed
Neutrophils and Activated Macrophages Control Mucosal Immunity by Proteolytic Cleavage of Antileukoproteinase
Frontiers in immunology · 2018 · PubMed

MMP-9 cleaves antileukoproteinase in both its N-terminal and C-terminal domains, reducing its LPS-binding and anti-proteolytic activities.; Cleaved antileukoproteinase loses its ability to repress proinflammatory transcripts and protein secretion in LPS-stimulated monocytes.; Antileukoproteinase cleavage fragments were detected in lower airway secretions of bronchiectasis patients with high neutrophil and MMP-9 activity.; Other MMPs and serine proteases can also cleave antileukoproteinase, but with similar or reduced efficiency compared to MMP-9.

Antileukoproteinase protects against hepatic inflammation, but not apoptosis in the response of D-galactosamine-sensitized mice to lipopolysaccharide
British journal of pharmacology · 2007 · PubMed

Frequently asked questions

What is Antileukoproteinase?

Antileukoproteinase, also known as secretory leukocyte protease inhibitor (SLPI), is a 11.7 kDa serine protease inhibitor belonging to the WAP (whey acidic protein) four-disulfide core family. Its primary mechanism of action involves reversible, high-affinity inhibition of neutrophil-derived proteases such as elastase,

How does Antileukoproteinase work?

Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed:10702419, PubMed:2039600, PubMed:2110563, PubMed:24121345, PubMed:3462719, PubMed:3533531). Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide

What is the research status of Antileukoproteinase?

Antileukoproteinase is currently classified as experimental, with 92 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Antileukoproteinase?

Antileukoproteinase has a molecular weight of approximately 14326 g/mol.

Related peptides

Build on Antileukoproteinase data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key