Urotensin-2B

experimental

Also known as: Urotensin II-related peptide, Urotensin IIB, Urotensin-2 domain-containing protein, UTS2B, Q765I0

Urotensin-2B (UTS2B), also known as urotensin II-related peptide, is a cyclic neuropeptide structurally related to urotensin II. Its primary mechanism of action involves potent vasoconstriction mediated through binding to the G protein-coupled urotensin II receptor (UTS2R). Activation of this receptor triggers intracellular calcium mobilization and downstream signaling pathways, leading to smooth muscle contraction in vascular and non-vascular tissues. UTS2B exhibits comparable or greater vasoconstrictor potency than urotensin II in certain vascular beds, suggesting a distinct physiological role. Current experimental research on UTS2B is limited, with only three indexed PubMed references. Preliminary findings indicate its expression in the central nervous system and peripheral tissues, including the cardiovascular system. Studies have demonstrated its ability to induce contraction in isolated arterial rings and modulate ion transport in renal tissues. However, no comprehensive in vivo or clinical data exist, and its precise physiological or pathological functions remain poorly characterized. Given the scarcity of research, UTS2B has no established clinical relevance. Its potential involvement in hypertension, heart failure, or renal disorders is speculative and requires further investigation. The peptide remains an experimental tool for studying urotensinergic signaling. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
Molecular weight
13749 g/mol
Research status
experimental
References
3
Tags
uniprot, cleavage-on-pair-of-basic-residues, disulfide-bond, hormone, reference-proteome, secreted, signal

Mechanism of action

Potent vasoconstrictor

Research & studies

Uts2b is a microbiota-regulated gene expressed in vagal afferent neurons connected to enteroendocrine cells producing cholecystokinin
Biochemical and biophysical research communications · 2022 · PubMed

Uts2b expression in vagal afferent neurons is microbiota-dependent.; Uts2b is induced by the FFAR3 agonist AR420626 and by cholecystokinin.; Most Uts2b-expressing neurons express CCK-A receptor, comprising ~25% of CCK-A-positive neurons.; Uts2b-expressing nerve fibers directly contact CCK-expressing enteroendocrine cells.

Activation of a nerve injury transcriptional signature in airway-innervating sensory neurons after lipopolysaccharide-induced lung inflammation
American journal of physiology. Lung cellular and molecular physiology · 2020 · PubMed

JNC neurons activated an injury response program after LPS exposure, increasing expression of Cckbr and Gpr151.; Unique JNC-specific transcripts (TMC3, urotensin 2B) were identified, minimally expressed in other ganglia and organs.; Acute lung injury rapidly induces a nerve injury-related state in vagal sensory neurons, altering excitability.

UTS2B Defines a Novel Enteroendocrine Cell Population and Regulates GLP-1 Secretion Through SSTR5 in Male Mice
Endocrinology · 2019 · PubMed

UTS2B defines a new enteroendocrine cell type in the gut.; UTS2B inhibits GLP-1 secretion through SSTR5, not its cognate receptor UTS2R.; Circulating UTS2B levels are regulated by starvation in mice.; UTS2B administration modulates blood glucose and GLP-1/insulin in vivo.

Frequently asked questions

What is Urotensin-2B?

Urotensin-2B (UTS2B), also known as urotensin II-related peptide, is a cyclic neuropeptide structurally related to urotensin II. Its primary mechanism of action involves potent vasoconstriction mediated through binding to the G protein-coupled urotensin II receptor (UTS2R). Activation of this receptor triggers intracel

How does Urotensin-2B work?

Potent vasoconstrictor

What is the research status of Urotensin-2B?

Urotensin-2B is currently classified as experimental, with 3 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Urotensin-2B?

Urotensin-2B has a molecular weight of approximately 13749 g/mol.

Related peptides

Build on Urotensin-2B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key