Urotensin-2

experimental

Also known as: Urotensin II, UTS2, O95399

Urotensin-2 (U-II) is a cyclic undecapeptide that acts as one of the most potent endogenous vasoconstrictors identified to date, with potency up to 10–100 times greater than endothelin-1 in certain vascular beds. Its mechanism of action is mediated through binding to the G-protein-coupled receptor GPR14 (UTS2R), which activates phospholipase C, leading to intracellular calcium mobilization and smooth muscle contraction. U-II also exerts pleiotropic effects, including modulation of cardiac contractility, vascular smooth muscle cell proliferation, and pro-inflammatory signaling, depending on tissue context and species. Key research findings indicate that U-II and its receptor are widely expressed in the cardiovascular, renal, and central nervous systems. Elevated plasma U-II levels have been observed in conditions such as hypertension, heart failure, atherosclerosis, and chronic kidney disease, suggesting a role in disease pathophysiology. Experimental studies in animal models have demonstrated that U-II contributes to myocardial fibrosis, endothelial dysfunction, and renal injury, while UTS2R antagonists have shown potential in attenuating these effects. However, translational outcomes remain inconsistent, and the precise physiological role of U-II in humans is still under investigation. Clinically, U-II is considered an experimental target for cardiovascular and renal disorders, though no UTS2R-targeted therapies have been approved. Its complex, context-dependent actions—including paradoxical vasodilatory effects in some vascular beds—pose challenges for therapeutic development. Ongoing research aims to clarify its biomarker potential and the utility of receptor modulation in disease management. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Molecular weight
1388.6 g/mol
Molecular formula
C64H85N13O18S2
CAS number
9047-55-6
Research status
experimental
References
36
Tags
uniprot, 3d-structure, alternative-splicing, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, disulfide-bond, hormone, reference-proteome, secreted, signal

Mechanism of action

Highly potent vasoconstrictor

Research & studies

Expression, purification, and preliminary cryo-EM analysis of the human urotensin 2 receptor/urotensin 2 complex
Protein expression and purification · 2026 · PubMed
Tulp3 deficiency results in ciliopathy phenotypes during zebrafish embryogenesis
Scientific reports · 2025 · PubMed
Plasma urotensin-2 levels as a potential biomarker in prostate cancer: Analysis across disease stages
Medicine · 2025 · PubMed
Urp1 and Urp2 act redundantly to maintain spine shape in zebrafish larvae
Developmental biology · 2023 · PubMed
Integrative RNA profiling of TBEV-infected neurons and astrocytes reveals potential pathogenic effectors
Computational and structural biotechnology journal · 2022 · PubMed

Severe TBEV strain caused high neuronal death, while both strains had low cytopathic effect in astrocytes.; Infection with severe TBEV altered inflammatory, immune, and nervous system development pathways in neurons.; Candidate mechanisms include miRNA/lncRNA regulation and virus-driven host pre-mRNA splicing modulation.; First comprehensive transcriptome overview of human astrocytes and neurons infected with TBEV strains of different virulence.

The Relationship of the Urotensin-2 Level in the Aqueous Humor with Systemic Diseases and Pupil Size: Comparative Study
Journal of ocular pharmacology and therapeutics : the official journal of the Association for Ocular Pharmacology and Therapeutics · 2021 · PubMed
An investigation of saliva and plasma levels of urotensin 2 in recently diagnosed type 2 diabetes mellitus patients on metformin treatment
Endokrynologia Polska · 2020 · PubMed
Urotensin 2 and Oxidative Stress Levels in Maternal Serum in Pregnancies Complicated by Intrauterine Growth Restriction
Medicina (Kaunas, Lithuania) · 2019 · PubMed

Frequently asked questions

What is Urotensin-2?

Urotensin-2 (U-II) is a cyclic undecapeptide that acts as one of the most potent endogenous vasoconstrictors identified to date, with potency up to 10–100 times greater than endothelin-1 in certain vascular beds. Its mechanism of action is mediated through binding to the G-protein-coupled receptor GPR14 (UTS2R), which

How does Urotensin-2 work?

Highly potent vasoconstrictor

What is the research status of Urotensin-2?

Urotensin-2 is currently classified as experimental, with 36 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Urotensin-2?

Urotensin-2 has a molecular weight of approximately 1388.6 g/mol (formula C64H85N13O18S2).

Related peptides

Build on Urotensin-2 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key