Urotensin-2
experimentalAlso known as: Urotensin II, UTS2, O95399
Urotensin-2 (U-II) is a cyclic undecapeptide that acts as one of the most potent endogenous vasoconstrictors identified to date, with potency up to 10–100 times greater than endothelin-1 in certain vascular beds. Its mechanism of action is mediated through binding to the G-protein-coupled receptor GPR14 (UTS2R), which activates phospholipase C, leading to intracellular calcium mobilization and smooth muscle contraction. U-II also exerts pleiotropic effects, including modulation of cardiac contractility, vascular smooth muscle cell proliferation, and pro-inflammatory signaling, depending on tissue context and species. Key research findings indicate that U-II and its receptor are widely expressed in the cardiovascular, renal, and central nervous systems. Elevated plasma U-II levels have been observed in conditions such as hypertension, heart failure, atherosclerosis, and chronic kidney disease, suggesting a role in disease pathophysiology. Experimental studies in animal models have demonstrated that U-II contributes to myocardial fibrosis, endothelial dysfunction, and renal injury, while UTS2R antagonists have shown potential in attenuating these effects. However, translational outcomes remain inconsistent, and the precise physiological role of U-II in humans is still under investigation. Clinically, U-II is considered an experimental target for cardiovascular and renal disorders, though no UTS2R-targeted therapies have been approved. Its complex, context-dependent actions—including paradoxical vasodilatory effects in some vascular beds—pose challenges for therapeutic development. Ongoing research aims to clarify its biomarker potential and the utility of receptor modulation in disease management. For research purposes only — not medical advice.
Key data
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCVC64H85N13O18S2Mechanism of action
Highly potent vasoconstrictor
Research & studies
Severe TBEV strain caused high neuronal death, while both strains had low cytopathic effect in astrocytes.; Infection with severe TBEV altered inflammatory, immune, and nervous system development pathways in neurons.; Candidate mechanisms include miRNA/lncRNA regulation and virus-driven host pre-mRNA splicing modulation.; First comprehensive transcriptome overview of human astrocytes and neurons infected with TBEV strains of different virulence.
Frequently asked questions
What is Urotensin-2?
Urotensin-2 (U-II) is a cyclic undecapeptide that acts as one of the most potent endogenous vasoconstrictors identified to date, with potency up to 10–100 times greater than endothelin-1 in certain vascular beds. Its mechanism of action is mediated through binding to the G-protein-coupled receptor GPR14 (UTS2R), which
How does Urotensin-2 work?
Highly potent vasoconstrictor
What is the research status of Urotensin-2?
Urotensin-2 is currently classified as experimental, with 36 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Urotensin-2?
Urotensin-2 has a molecular weight of approximately 1388.6 g/mol (formula C64H85N13O18S2).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Urotensin-2 data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key