Urocortin

experimental

Also known as: UCN, P55089

**Mechanism of Action** Urocortin (UCN) is a 40-amino acid peptide belonging to the corticotropin-releasing factor (CRF) family, binding with high affinity to CRF receptor type 2 (CRF-R2) and, to a lesser extent, CRF-R1. It activates Gs-protein-coupled signaling, increasing intracellular cAMP and downstream protein kinase A (PKA) activity. Urocortin modulates the hypothalamic-pituitary-adrenal (HPA) axis, autonomic nervous system, and peripheral stress responses, including regulation of appetite, cardiovascular function, and immune modulation. Its effects are tissue-specific, with CRF-R2 predominantly expressed in peripheral tissues (e.g., heart, skeletal muscle, gastrointestinal tract) and discrete brain regions. **Key Research Findings** Preclinical studies demonstrate urocortin’s role in stress adaptation, including suppression of food intake, enhancement of anxiety-like behaviors, and modulation of cardiovascular function (e.g., vasodilation, positive inotropy). In rodent models, urocortin administration reduces inflammation and protects against ischemia-reperfusion injury in cardiac and cerebral tissues. It also influences energy balance by increasing thermogenesis and lipid oxidation. However, its anorexigenic and stress-related effects limit therapeutic translation. Experimental status indicates ongoing investigation into analogs with improved receptor selectivity and pharmacokinetics. **Clinical Relevance** Urocortin’s potential applications include stress-related disorders (e.g., anxiety, depression), metabolic syndrome, and cardiovascular protection. No approved human therapies exist; research remains preclinical. Challenges include off-target CRF-R1 activation (promoting anxiety) and short half-life. Future directions focus on CRF-R2-selective agonists for conditions like heart failure or obesity, though safety and efficacy data are lacking. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK
Molecular weight
482.5 g/mol
Molecular formula
C28H26N4O4
CAS number
112953-11-4
Research status
experimental
References
1,436
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, hearing, hormone, reference-proteome, secreted, signal

Mechanism of action

Hormone that plays a central role in whole body adaptation to stress (PubMed:20966082, PubMed:24290358, PubMed:32004470, PubMed:36335102, PubMed:8612563). Released by the hypothalamus primarily in response to physical or psychological stress and acts by binding to CRH receptors CRHR1 and CRHR2 (PubMed:24290358, PubMed:26350463, PubMed:32004470, PubMed:36335102, PubMed:8612563). UCN-dependent signaling is a primary mediator of the neuroendocrine, autonomic (fight-or-flight) and behavioral responses to stress, acting as a key regulator of adaptation by activating the hypothalamus-pituitary-adrenal axis, leading to corticotropin hormone (ACTH) production (PubMed:8612563). Plays a role in the establishment of normal hearing thresholds (By similarity). Reduces food intake and regulates ghrelin levels in gastric body and plasma (By similarity)

Research & studies

Edinger-Westphal Urocortin-1 neurons regulate consumption and affect
Cell reports · 2025 · PubMed
Crinecerfont in a First Clinical Application of a CRH Antagonist: Further Potential Uses Are Still an Open Chapter!
The Journal of clinical endocrinology and metabolism · 2024 · PubMed
Linking stress with urocortin in rats
Bioinformation · 2023 · PubMed
Urocortin 3 function in glucose metabolism
Nature reviews. Endocrinology · 2022 · PubMed
Contribution of Urocortin to the Development of Excessive Drinking
International review of neurobiology · 2017 · PubMed
Urocortin--from Parkinson's disease to the skeleton
The international journal of biochemistry & cell biology · 2015 · PubMed
[Urocortin]
Nihon rinsho. Japanese journal of clinical medicine · 2010 · PubMed
Urocortin and the brain
Progress in neurobiology · 2008 · PubMed

Urocortin potently suppresses food intake via CRH receptors in the brain.; Urocortin regulates anxiety, learning, memory, body temperature, and shows neuroprotection.; Urocortin interacts with leptin, neuropeptide Y, orexin, and corticotropin in the brain.; Blood-borne urocortin crosses the blood-brain barrier via a unique transport system.

Frequently asked questions

What is Urocortin?

**Mechanism of Action** Urocortin (UCN) is a 40-amino acid peptide belonging to the corticotropin-releasing factor (CRF) family, binding with high affinity to CRF receptor type 2 (CRF-R2) and, to a lesser extent, CRF-R1. It activates Gs-protein-coupled signaling, increasing intracellular cAMP and downstream protein kin

How does Urocortin work?

Hormone that plays a central role in whole body adaptation to stress (PubMed:20966082, PubMed:24290358, PubMed:32004470, PubMed:36335102, PubMed:8612563). Released by the hypothalamus primarily in response to physical or psychological stress and acts by binding to CRH receptors CRHR1 and CRHR2 (PubMed:24290358, PubMed:26350463, PubMed:32004470, PubMed:36335102, PubMed:8612563). UCN-dependent signa

What is the research status of Urocortin?

Urocortin is currently classified as experimental, with 1,436 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Urocortin?

Urocortin has a molecular weight of approximately 482.5 g/mol (formula C28H26N4O4).

Related peptides

Build on Urocortin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key