Tachykinin-3
experimentalAlso known as: ZNEUROK1, TAC3, Q9UHF0
**Mechanism of Action** Tachykinin-3 (TAC3), encoded by the *TAC3* gene, is a member of the tachykinin peptide family, which includes substance P and neurokinin A. It primarily acts as an agonist at neurokinin-3 receptors (NK3R), a G-protein-coupled receptor expressed in the central nervous system and peripheral tissues. Activation of NK3R triggers phospholipase C-mediated intracellular signaling, leading to calcium mobilization and modulation of neuronal excitability. Tachykinin-3 is involved in neurotransmission, smooth muscle contraction, vasodilation, and secretagogue activity, with particular roles in regulating reproductive function, stress responses, and pain processing. **Key Research Findings** Preclinical studies demonstrate that TAC3 signaling is critical for gonadotropin-releasing hormone (GnRH) secretion and reproductive maturation, as mutations in *TAC3* or its receptor cause hypogonadotropic hypogonadism in humans. Animal models show that TAC3 modulates dopaminergic and serotonergic pathways, influencing anxiety-like behaviors and locomotor activity. Additionally, TAC3 has been implicated in neurogenic inflammation and visceral hypersensitivity, with NK3R antagonists showing efficacy in reducing stress-induced colonic motility in rodent models. Current research remains experimental, with 27 PubMed-indexed studies exploring its roles in neuroendocrine regulation, pain, and psychiatric disorders. **Clinical Relevance** While TAC3 is not yet a therapeutic target, its involvement in reproductive disorders and stress-related conditions positions it as a candidate for drug development. NK3R antagonists are under investigation for treating hot flashes, schizophrenia, and irritable bowel syndrome. However, no TAC3-based therapies have advanced to clinical approval. For research purposes only — not medical advice.
Key data
MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAEC55H79N13O14S2Mechanism of action
Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
Research & studies
An arrayed screen of 14 morphogen modulators in human neural organoids was performed over 70 days.; Deconvolution of single-cell-multiplexed RNA sequencing data revealed design principles of brain region specification.; Tuned neural subtype diversity generated TAC3-expressing striatal interneurons within assembloids.; Neonatal rat transplantation enabled human Purkinje neurons to develop hallmark complex dendritic branching.
Maternal age at menarche is associated with pubertal timing in offspring, indicating a genetic background for ICPP.; Gain-of-expression in KISS1, gain-of-function in KISS1R, and loss-of-function in MKRN3 and DLK1 are linked to ICPP.; Environmental and socioeconomic factors may also correlate with ICPP.; Epigenetic factors like DNA methylation and noncoding RNAs may mediate genetic-environmental interactions in CPP.
Frequently asked questions
What is Tachykinin-3?
**Mechanism of Action** Tachykinin-3 (TAC3), encoded by the *TAC3* gene, is a member of the tachykinin peptide family, which includes substance P and neurokinin A. It primarily acts as an agonist at neurokinin-3 receptors (NK3R), a G-protein-coupled receptor expressed in the central nervous system and peripheral tissue
How does Tachykinin-3 work?
Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
What is the research status of Tachykinin-3?
Tachykinin-3 is currently classified as experimental, with 27 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Tachykinin-3?
Tachykinin-3 has a molecular weight of approximately 1210.4 g/mol (formula C55H79N13O14S2).
Related peptides
CNTF-derived peptidergic compound that promotes neurogenesis and reduces tau pathology in preclinical Alzheimer's models.
33-aa hypothalamic neuropeptide acting on OX1/OX2 receptors to promote wakefulness and arousal.
Porcine brain-derived peptide preparation with neurotrophic-factor-like activity studied in stroke, TBI, and dementia.
Ligand for NPSR1 . Binds to its receptor with nanomolar affinity and initiates a G /GNAQ-dependent phospholipase C-activating signaling pathway. This results in Ca mobilization from intracellular stores and increased int…
NCAM-derived FG-loop peptide that activates FGFR1 to enhance synaptic plasticity and memory in animal models.
May function as an output molecule from the suprachiasmatic nucleus that transmits behavioral circadian rhythm.
Build on Tachykinin-3 data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key