Tachykinin-3

experimental

Also known as: ZNEUROK1, TAC3, Q9UHF0

**Mechanism of Action** Tachykinin-3 (TAC3), encoded by the *TAC3* gene, is a member of the tachykinin peptide family, which includes substance P and neurokinin A. It primarily acts as an agonist at neurokinin-3 receptors (NK3R), a G-protein-coupled receptor expressed in the central nervous system and peripheral tissues. Activation of NK3R triggers phospholipase C-mediated intracellular signaling, leading to calcium mobilization and modulation of neuronal excitability. Tachykinin-3 is involved in neurotransmission, smooth muscle contraction, vasodilation, and secretagogue activity, with particular roles in regulating reproductive function, stress responses, and pain processing. **Key Research Findings** Preclinical studies demonstrate that TAC3 signaling is critical for gonadotropin-releasing hormone (GnRH) secretion and reproductive maturation, as mutations in *TAC3* or its receptor cause hypogonadotropic hypogonadism in humans. Animal models show that TAC3 modulates dopaminergic and serotonergic pathways, influencing anxiety-like behaviors and locomotor activity. Additionally, TAC3 has been implicated in neurogenic inflammation and visceral hypersensitivity, with NK3R antagonists showing efficacy in reducing stress-induced colonic motility in rodent models. Current research remains experimental, with 27 PubMed-indexed studies exploring its roles in neuroendocrine regulation, pain, and psychiatric disorders. **Clinical Relevance** While TAC3 is not yet a therapeutic target, its involvement in reproductive disorders and stress-related conditions positions it as a candidate for drug development. NK3R antagonists are under investigation for treating hot flashes, schizophrenia, and irritable bowel syndrome. However, no TAC3-based therapies have advanced to clinical approval. For research purposes only — not medical advice.

Key data

Category
Cognitive & Neuroprotective
Sequence
MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Molecular weight
1210.4 g/mol
Molecular formula
C55H79N13O14S2
CAS number
86933-75-7
Research status
experimental
References
27
Tags
uniprot, 3d-structure, alternative-splicing, amidation, cleavage-on-pair-of-basic-residues, disease-variant, hypogonadotropic-hypogonadism, neuropeptide, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles

Research & studies

Generating human neural diversity with a multiplexed morphogen screen in organoids
Cell stem cell · 2024 · PubMed

An arrayed screen of 14 morphogen modulators in human neural organoids was performed over 70 days.; Deconvolution of single-cell-multiplexed RNA sequencing data revealed design principles of brain region specification.; Tuned neural subtype diversity generated TAC3-expressing striatal interneurons within assembloids.; Neonatal rat transplantation enabled human Purkinje neurons to develop hallmark complex dendritic branching.

Altered expression of kisspeptin, dynorphin, and related neuropeptides in polycystic ovary syndrome: A cross-sectional study
International journal of reproductive biomedicine · 2024 · PubMed
Estrogen promotes gonadotropin-releasing hormone expression by regulating tachykinin 3 and prodynorphin systems in chicken
Poultry science · 2024 · PubMed
TAC3 regulates GnRH/gonadotropin synthesis in female chickens
Theriogenology · 2024 · PubMed
Interneuron diversity in the human dorsal striatum
Research square · 2023 · PubMed
Tachykinins, new players in the control of reproduction and food intake: A comparative review in mammals and teleosts
Frontiers in endocrinology · 2022 · PubMed
Genetic factors in precocious puberty
Clinical and experimental pediatrics · 2022 · PubMed

Maternal age at menarche is associated with pubertal timing in offspring, indicating a genetic background for ICPP.; Gain-of-expression in KISS1, gain-of-function in KISS1R, and loss-of-function in MKRN3 and DLK1 are linked to ICPP.; Environmental and socioeconomic factors may also correlate with ICPP.; Epigenetic factors like DNA methylation and noncoding RNAs may mediate genetic-environmental interactions in CPP.

Knockout of tac3 genes in zebrafish shows no impairment of reproduction
General and comparative endocrinology · 2021 · PubMed

Frequently asked questions

What is Tachykinin-3?

**Mechanism of Action** Tachykinin-3 (TAC3), encoded by the *TAC3* gene, is a member of the tachykinin peptide family, which includes substance P and neurokinin A. It primarily acts as an agonist at neurokinin-3 receptors (NK3R), a G-protein-coupled receptor expressed in the central nervous system and peripheral tissue

How does Tachykinin-3 work?

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles

What is the research status of Tachykinin-3?

Tachykinin-3 is currently classified as experimental, with 27 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Tachykinin-3?

Tachykinin-3 has a molecular weight of approximately 1210.4 g/mol (formula C55H79N13O14S2).

Related peptides

Build on Tachykinin-3 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key