Spexin
experimentalAlso known as: NPQ, Neuropeptide Q, Spexin hormone, SPX, Q9BT56
**Mechanism of Action** Spexin (SPX), also known as Neuropeptide Q, is a 14-amino acid peptide encoded by the *SPX* gene. It acts primarily through the galanin receptor subtypes GALR2 and GALR3, with high affinity for GALR2/3 over GALR1. Central and peripheral SPX signaling modulates autonomic nervous system activity, influencing cardiovascular regulation (e.g., blood pressure and heart rate), renal function (e.g., diuresis and electrolyte balance), and nociceptive processing. Its effects are mediated via G-protein-coupled receptor pathways, including inhibition of cAMP production and activation of MAPK/ERK signaling. **Key Research Findings** Preclinical studies demonstrate that central administration of SPX reduces mean arterial pressure and heart rate in rodent models, suggesting a role in blood pressure homeostasis. In renal tissues, SPX promotes natriuresis and diuresis, potentially via modulation of aquaporin and sodium transporter expression. Additionally, SPX exhibits antinociceptive properties in inflammatory and neuropathic pain models, likely through spinal and supraspinal GALR2/3 activation. Experimental data also link SPX to energy balance and stress responses, though these findings remain preliminary. **Clinical Relevance** As an experimental peptide, SPX has not been evaluated in human clinical trials. Its potential therapeutic applications include hypertension, fluid retention disorders, and chronic pain management, but translational gaps remain due to limited pharmacokinetic and safety data. Current evidence is confined to animal models and *in vitro* systems, necessitating further validation. For research purposes only — not medical advice.
Key data
MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNWC74H114N20O19SMechanism of action
Plays a role as a central modulator of cardiovascular and renal function and nociception. Also plays a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release (By similarity)
Research & studies
Spexin improved cardiac function and reduced serum cardiac troponin T and CKMB levels in doxorubicin-treated mice.; Spexin decreased iron accumulation, lipid peroxidation, and ferroptosis-associated protein changes in cardiomyocytes.; Doxorubicin caused excessive autophagy in cardiomyocytes, which was alleviated by spexin treatment.; Knockdown of Beclin 1 eliminated the protective effects of spexin against doxorubicin-induced cardiotoxicity.
Spexin plasma levels were lower in AF patients, and spexin knockout increased AF susceptibility in mice.; GALR2 knockout, but not GALR1 or GALR3, increased AF incidence with higher I_K1 current and Ca2+ overload.; Spexin treatment suppressed CREB signaling, decreased I_K1 current and Ca2+ overload, reducing AF inducibility in Ang-II-infused mice.; The spexin/GALR2/CREB pathway regulates KCNJ2 and SLN transcription, offering a novel therapeutic target for AF.
Frequently asked questions
What is Spexin?
**Mechanism of Action** Spexin (SPX), also known as Neuropeptide Q, is a 14-amino acid peptide encoded by the *SPX* gene. It acts primarily through the galanin receptor subtypes GALR2 and GALR3, with high affinity for GALR2/3 over GALR1. Central and peripheral SPX signaling modulates autonomic nervous system activity,
How does Spexin work?
Plays a role as a central modulator of cardiovascular and renal function and nociception. Also plays a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release (By similarity)
What is the research status of Spexin?
Spexin is currently classified as experimental, with 248 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Spexin?
Spexin has a molecular weight of approximately 1619.9 g/mol (formula C74H114N20O19S).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Spexin data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key