Spexin

experimental

Also known as: NPQ, Neuropeptide Q, Spexin hormone, SPX, Q9BT56

**Mechanism of Action** Spexin (SPX), also known as Neuropeptide Q, is a 14-amino acid peptide encoded by the *SPX* gene. It acts primarily through the galanin receptor subtypes GALR2 and GALR3, with high affinity for GALR2/3 over GALR1. Central and peripheral SPX signaling modulates autonomic nervous system activity, influencing cardiovascular regulation (e.g., blood pressure and heart rate), renal function (e.g., diuresis and electrolyte balance), and nociceptive processing. Its effects are mediated via G-protein-coupled receptor pathways, including inhibition of cAMP production and activation of MAPK/ERK signaling. **Key Research Findings** Preclinical studies demonstrate that central administration of SPX reduces mean arterial pressure and heart rate in rodent models, suggesting a role in blood pressure homeostasis. In renal tissues, SPX promotes natriuresis and diuresis, potentially via modulation of aquaporin and sodium transporter expression. Additionally, SPX exhibits antinociceptive properties in inflammatory and neuropathic pain models, likely through spinal and supraspinal GALR2/3 activation. Experimental data also link SPX to energy balance and stress responses, though these findings remain preliminary. **Clinical Relevance** As an experimental peptide, SPX has not been evaluated in human clinical trials. Its potential therapeutic applications include hypertension, fluid retention disorders, and chronic pain management, but translational gaps remain due to limited pharmacokinetic and safety data. Current evidence is confined to animal models and *in vitro* systems, necessitating further validation. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
Molecular weight
1619.9 g/mol
Molecular formula
C74H114N20O19S
CAS number
1370290-58-6
Research status
experimental
References
248
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, cytoplasmic-vesicle, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Plays a role as a central modulator of cardiovascular and renal function and nociception. Also plays a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release (By similarity)

Research & studies

Peptide hormone spexin restores beta cell function and improves glycaemic control in mice via regulation of the sodium-potassium pump
Diabetologia · 2026 · PubMed
The Effect of Exercise on Spexin and Follistatin in Elderly Individuals
Journal of cachexia, sarcopenia and muscle · 2025 · PubMed
Isthmin-1 and spexin as promising novel biomarker candidates for invasive ductal breast carcinoma
Tissue & cell · 2024 · PubMed
Spexin inhibits excessive autophagy-induced ferroptosis to alleviate doxorubicin-induced cardiotoxicity by upregulating Beclin 1
British journal of pharmacology · 2024 · PubMed

Spexin improved cardiac function and reduced serum cardiac troponin T and CKMB levels in doxorubicin-treated mice.; Spexin decreased iron accumulation, lipid peroxidation, and ferroptosis-associated protein changes in cardiomyocytes.; Doxorubicin caused excessive autophagy in cardiomyocytes, which was alleviated by spexin treatment.; Knockdown of Beclin 1 eliminated the protective effects of spexin against doxorubicin-induced cardiotoxicity.

Novel hypothalamic pathways for metabolic effects of spexin
Pharmacological research · 2024 · PubMed
Spexin Diminishes Atrial Fibrillation Vulnerability by Acting on Galanin Receptor 2
Circulation · 2024 · PubMed

Spexin plasma levels were lower in AF patients, and spexin knockout increased AF susceptibility in mice.; GALR2 knockout, but not GALR1 or GALR3, increased AF incidence with higher I_K1 current and Ca2+ overload.; Spexin treatment suppressed CREB signaling, decreased I_K1 current and Ca2+ overload, reducing AF inducibility in Ang-II-infused mice.; The spexin/GALR2/CREB pathway regulates KCNJ2 and SLN transcription, offering a novel therapeutic target for AF.

Advances in research on spexin-mediated regulation of reproductive function in vertebrates
Frontiers in endocrinology · 2024 · PubMed
Normalization of Spexin Levels in Patients with Obesity Submitted to Bariatric Surgery
Obesity surgery · 2024 · PubMed

Frequently asked questions

What is Spexin?

**Mechanism of Action** Spexin (SPX), also known as Neuropeptide Q, is a 14-amino acid peptide encoded by the *SPX* gene. It acts primarily through the galanin receptor subtypes GALR2 and GALR3, with high affinity for GALR2/3 over GALR1. Central and peripheral SPX signaling modulates autonomic nervous system activity,

How does Spexin work?

Plays a role as a central modulator of cardiovascular and renal function and nociception. Also plays a role in energy metabolism and storage. Inhibits adrenocortical cell proliferation with minor stimulation on corticosteroid release (By similarity)

What is the research status of Spexin?

Spexin is currently classified as experimental, with 248 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Spexin?

Spexin has a molecular weight of approximately 1619.9 g/mol (formula C74H114N20O19S).

Related peptides

Build on Spexin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key