peptides.api

Somatostatin

approved

Also known as: Growth hormone release-inhibiting factor, SST, P61278

Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin

Key data

Category
Hormonal & Endocrine
Sequence
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Molecular weight
12736 g/mol
Research status
approved
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, disulfide-bond, hormone, pharmaceutical, proteomics-identification, reference-proteome, secreted, signal

Frequently asked questions

What is Somatostatin?

Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin

How does Somatostatin work?

Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin

What is the research status of Somatostatin?

Somatostatin is currently classified as approved. This is for research purposes only and is not medical advice.

What is the molecular weight of Somatostatin?

Somatostatin has a molecular weight of approximately 12736 g/mol.

Related peptides

Insulin

Insulin decreases blood glucose concentration.

Parathyroid hormone

Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .

Calcitonin

Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Oxytocin

Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.

Osteocalcin

The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .

Gastrin

Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.

Build on Somatostatin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key