Secretin

experimental

Also known as: SCT, P09683

**Mechanism of Action** Secretin (SCT; gene ID P09683) is a 27-amino-acid peptide hormone primarily secreted by S cells of the duodenum in response to gastric acid. Its canonical mechanism involves binding to the secretin receptor (SCTR), a class B G-protein-coupled receptor, which activates adenylate cyclase and increases intracellular cyclic AMP. This signaling cascade stimulates pancreatic ductal cells to secrete bicarbonate-rich fluid, neutralizing duodenal pH. Additionally, secretin modulates central and peripheral pathways regulating food intake (via vagal afferents and hypothalamic nuclei) and water homeostasis (through renal and osmoregulatory effects). **Key Research Findings** Experimental studies have elucidated secretin’s role beyond gastrointestinal physiology. In the central nervous system, secretin and its receptor are expressed in hypothalamic regions controlling appetite and energy balance; animal models show that central secretin administration reduces food intake and body weight. Research also indicates secretin influences water homeostasis by modulating aquaporin expression in renal collecting ducts and vasopressin release. Despite these findings, clinical translation remains limited, with most data derived from preclinical models. The peptide’s therapeutic potential in metabolic disorders and fluid balance disturbances is under investigation, but no approved clinical applications exist. **Clinical Relevance** Secretin is currently classified as experimental, with no established therapeutic indications. Historical use in diagnostic pancreatic function testing has been largely replaced by non-invasive methods. Ongoing research explores its utility in conditions such as obesity, diabetes, and autism spectrum disorder (based on early, inconclusive trials). However, robust clinical evidence is lacking, and safety profiles in chronic use remain uncharacterized. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
Molecular weight
3056.4 g/mol
Molecular formula
C130H219N43O42
CAS number
1393-25-5
Research status
experimental
References
7,330
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, hormone, phosphoprotein, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973). Exerts its biological effects by binding to secretin receptor (SCTR), a G protein-coupled receptor expressed in the basolateral domain of several cells (PubMed:25332973, PubMed:33008599, PubMed:32811827). Acts as a key gastrointestinal hormone by regulating the pH of the duodenal content (By similarity). Secreted by S cells of the duodenum in the crypts of Lieberkuehn and regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas (By similarity). Production of bicarbonate is essential to neutralize the pH and ensure no damage is done to the small intestine by the gastric acid (By similarity). In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation (Probable). Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation (By similarity). Also able to stimulate lipolysis in white adipocytes (By similarity). Also plays an important role in cellular osmoregulation: released into the systemic circulation in response to hyperosmolality and acts at different levels in the hypothalamus, pituitary and kidney to regulate water homeostasis (By similarity). Also plays a role in the central nervous system, possibly by acting as a neuropeptide hormone: required for hippocampal synaptic function and neural progenitor cells maintenance (By similarity)

Research & studies

Secretin targets interstitial cells of Cajal to regulate intestinal contractions
EMBO reports · 2025 · PubMed
Physiology, Secretin
2023 · PubMed
Functional Role of the Secretin/Secretin Receptor Signaling During Cholestatic Liver Injury
Hepatology (Baltimore, Md.) · 2020 · PubMed
Distribution and Functional Implication of Secretin in Multiple Brain Regions
Journal of molecular neuroscience : MN · 2019 · PubMed
Secretin-enhanced MR Imaging of the Pancreas
Radiology · 2016 · PubMed
Molecular evolution of GPCRs: Secretin/secretin receptors
Journal of molecular endocrinology · 2014 · PubMed

Secretin is only identified in tetrapods, with the earliest diverged secretin found in frogs, and is highly conserved in mammals.; Secretin receptor is present in both actinopterygian and sarcopterygian fish, but the zebrafish receptor is nonbioactive.; The earliest bioactive secretin receptor is in lungfish, suggesting descent from a VPAC-like receptor before the Actinopterygii-Sarcopterygii split.; Secretin and its receptor evolved independently, with a functional axis likely emerging in amphibians.

Secretin: historical perspective and current status
Pancreas · 2014 · PubMed

Secretin's role in pancreatic secretion requires potentiation by cholecystokinin and involves vagovagal reflex mechanisms.; Secretin-releasing peptides have been identified in duodenal acid perfusates and pancreatic juice.; Insulin modulates secretin's action in the pancreas by suppressing local somatostatin and pancreatic polypeptide release.; Synthetic human secretin is used for pancreatic function tests, secretin-enhanced MRCP, and diagnosis of gastrinoma, with potential therapeutic use for pain in chronic pancreatitis.

The physiological roles of secretin and its receptor
Annals of translational medicine · 2013 · PubMed

Frequently asked questions

What is Secretin?

**Mechanism of Action** Secretin (SCT; gene ID P09683) is a 27-amino-acid peptide hormone primarily secreted by S cells of the duodenum in response to gastric acid. Its canonical mechanism involves binding to the secretin receptor (SCTR), a class B G-protein-coupled receptor, which activates adenylate cyclase and incre

How does Secretin work?

Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973). Exerts its biological effects by binding to secretin receptor (SCTR), a G protein-coupled receptor expressed in the basolateral domain of several cells (PubMed:25332973, PubMed:33008599, PubMed:32811827). Acts as a key gastrointestinal hormone by regul

What is the research status of Secretin?

Secretin is currently classified as experimental, with 7,330 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Secretin?

Secretin has a molecular weight of approximately 3056.4 g/mol (formula C130H219N43O42).

Related peptides

Build on Secretin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key