Secretin
experimentalAlso known as: SCT, P09683
**Mechanism of Action** Secretin (SCT; gene ID P09683) is a 27-amino-acid peptide hormone primarily secreted by S cells of the duodenum in response to gastric acid. Its canonical mechanism involves binding to the secretin receptor (SCTR), a class B G-protein-coupled receptor, which activates adenylate cyclase and increases intracellular cyclic AMP. This signaling cascade stimulates pancreatic ductal cells to secrete bicarbonate-rich fluid, neutralizing duodenal pH. Additionally, secretin modulates central and peripheral pathways regulating food intake (via vagal afferents and hypothalamic nuclei) and water homeostasis (through renal and osmoregulatory effects). **Key Research Findings** Experimental studies have elucidated secretin’s role beyond gastrointestinal physiology. In the central nervous system, secretin and its receptor are expressed in hypothalamic regions controlling appetite and energy balance; animal models show that central secretin administration reduces food intake and body weight. Research also indicates secretin influences water homeostasis by modulating aquaporin expression in renal collecting ducts and vasopressin release. Despite these findings, clinical translation remains limited, with most data derived from preclinical models. The peptide’s therapeutic potential in metabolic disorders and fluid balance disturbances is under investigation, but no approved clinical applications exist. **Clinical Relevance** Secretin is currently classified as experimental, with no established therapeutic indications. Historical use in diagnostic pancreatic function testing has been largely replaced by non-invasive methods. Ongoing research explores its utility in conditions such as obesity, diabetes, and autism spectrum disorder (based on early, inconclusive trials). However, robust clinical evidence is lacking, and safety profiles in chronic use remain uncharacterized. For research purposes only — not medical advice.
Key data
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPRC130H219N43O42Mechanism of action
Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973). Exerts its biological effects by binding to secretin receptor (SCTR), a G protein-coupled receptor expressed in the basolateral domain of several cells (PubMed:25332973, PubMed:33008599, PubMed:32811827). Acts as a key gastrointestinal hormone by regulating the pH of the duodenal content (By similarity). Secreted by S cells of the duodenum in the crypts of Lieberkuehn and regulates the pH of the duodenum by (1) inhibiting the secretion of gastric acid from the parietal cells of the stomach and (2) stimulating the production of bicarbonate (NaHCO(3)) from the ductal cells of the pancreas (By similarity). Production of bicarbonate is essential to neutralize the pH and ensure no damage is done to the small intestine by the gastric acid (By similarity). In addition to regulating the pH of the duodenal content, plays a central role in diet induced thermogenesis: acts as a non-sympathetic brown fat (BAT) activator mediating prandial thermogenesis, which consequentially induces satiation (Probable). Mechanistically, secretin released by the gut after a meal binds to secretin receptor (SCTR) in brown adipocytes, activating brown fat thermogenesis by stimulating lipolysis, which is sensed in the brain and promotes satiation (By similarity). Also able to stimulate lipolysis in white adipocytes (By similarity). Also plays an important role in cellular osmoregulation: released into the systemic circulation in response to hyperosmolality and acts at different levels in the hypothalamus, pituitary and kidney to regulate water homeostasis (By similarity). Also plays a role in the central nervous system, possibly by acting as a neuropeptide hormone: required for hippocampal synaptic function and neural progenitor cells maintenance (By similarity)
Research & studies
Secretin is only identified in tetrapods, with the earliest diverged secretin found in frogs, and is highly conserved in mammals.; Secretin receptor is present in both actinopterygian and sarcopterygian fish, but the zebrafish receptor is nonbioactive.; The earliest bioactive secretin receptor is in lungfish, suggesting descent from a VPAC-like receptor before the Actinopterygii-Sarcopterygii split.; Secretin and its receptor evolved independently, with a functional axis likely emerging in amphibians.
Secretin's role in pancreatic secretion requires potentiation by cholecystokinin and involves vagovagal reflex mechanisms.; Secretin-releasing peptides have been identified in duodenal acid perfusates and pancreatic juice.; Insulin modulates secretin's action in the pancreas by suppressing local somatostatin and pancreatic polypeptide release.; Synthetic human secretin is used for pancreatic function tests, secretin-enhanced MRCP, and diagnosis of gastrinoma, with potential therapeutic use for pain in chronic pancreatitis.
Frequently asked questions
What is Secretin?
**Mechanism of Action** Secretin (SCT; gene ID P09683) is a 27-amino-acid peptide hormone primarily secreted by S cells of the duodenum in response to gastric acid. Its canonical mechanism involves binding to the secretin receptor (SCTR), a class B G-protein-coupled receptor, which activates adenylate cyclase and incre
How does Secretin work?
Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973). Exerts its biological effects by binding to secretin receptor (SCTR), a G protein-coupled receptor expressed in the basolateral domain of several cells (PubMed:25332973, PubMed:33008599, PubMed:32811827). Acts as a key gastrointestinal hormone by regul
What is the research status of Secretin?
Secretin is currently classified as experimental, with 7,330 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Secretin?
Secretin has a molecular weight of approximately 3056.4 g/mol (formula C130H219N43O42).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Secretin data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key