Resistin

experimental

Also known as: Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3, RETN, Q9HD89

Resistin, also known as RETN or FIZZ3, is a cysteine-rich secreted protein primarily derived from adipose tissue in rodents and from macrophages in humans. Its mechanism of action involves antagonizing insulin signaling, specifically by reducing insulin-stimulated glucose uptake in adipocytes. This effect is mediated through interactions with putative receptors such as CAP1 (adenylyl cyclase-associated protein 1), leading to increased intracellular cAMP levels and subsequent activation of inflammatory pathways, including NF-κB and SOCS3. These signaling cascades impair insulin receptor substrate (IRS) phosphorylation and GLUT4 translocation, thereby promoting insulin resistance. Key research findings from over 5,600 PubMed references indicate that resistin is upregulated in obesity and correlates positively with insulin resistance and type 2 diabetes in human cohorts. Rodent studies demonstrate that resistin administration induces hyperglycemia and hepatic insulin resistance, while neutralization of resistin improves glucose tolerance. In humans, resistin is also implicated in chronic inflammation, atherosclerosis, and non-alcoholic fatty liver disease, with elevated serum levels associated with increased cardiovascular risk. However, species-specific differences in resistin expression and function complicate translational interpretation. Clinically, resistin is considered an experimental biomarker for metabolic and inflammatory diseases. Its potential as a therapeutic target remains under investigation, with ongoing studies exploring resistin antagonists or modulators of its signaling pathways. No approved therapies targeting resistin currently exist, and its clinical utility is limited to research contexts. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Molecular weight
11419 g/mol
Research status
experimental
References
5,635
Tags
uniprot, alternative-splicing, diabetes-mellitus, disulfide-bond, hormone, obesity, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells (By similarity). Potentially links obesity to diabetes (By similarity). Promotes chemotaxis in myeloid cells (PubMed:15064728)

Research & studies

An Updated Review of Resistin and Colorectal Cancer
Cureus · 2024 · PubMed
Resistin: A journey from metabolism to cancer
Translational oncology · 2021 · PubMed
Resistin, a Novel Host Defense Peptide of Innate Immunity
Frontiers in immunology · 2021 · PubMed
Resistin induces cardiac fibroblast-myofibroblast differentiation through JAK/STAT3 and JNK/c-Jun signaling
Pharmacological research · 2021 · PubMed

Resistin induced fibroblast-to-myofibroblast conversion with increased fibrotic markers (Sma, col1a1, Fn, Ccn2, Mmp9) and actin network changes.; Mechanistically, resistin acted through JAK2/STAT3 and JNK/c-Jun signaling, independent of TGF-β1.; Resistin-null mice on a high-fat diet showed improved cardiac function and decreased tissue fibrosis and fibrogenic marker expression.

Resistin: Potential biomarker and therapeutic target in atherosclerosis
Clinica chimica acta; international journal of clinical chemistry · 2021 · PubMed
Resistin: An inflammatory cytokine with multi-faceted roles in cancer
Biochimica et biophysica acta. Reviews on cancer · 2020 · PubMed
Resistin in metabolism, inflammation, and disease
The FEBS journal · 2020 · PubMed
Resistin: A reappraisal
Mechanisms of ageing and development · 2019 · PubMed

Resistin levels change during aging and may contribute to chronic disease and frailty.; High resistin levels induce insulin resistance and have proinflammatory effects.; Resistin plays a pivotal role in various metabolic, inflammatory, and autoimmune diseases.; Resistin is proposed as a molecular link between aging and age-related conditions.

Frequently asked questions

What is Resistin?

Resistin, also known as RETN or FIZZ3, is a cysteine-rich secreted protein primarily derived from adipose tissue in rodents and from macrophages in humans. Its mechanism of action involves antagonizing insulin signaling, specifically by reducing insulin-stimulated glucose uptake in adipocytes. This effect is mediated t

How does Resistin work?

Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells (By similarity). Potentially links obesity to diabetes (By similarity). Promotes chemotaxis in myeloid cells (PubMed:15064728)

What is the research status of Resistin?

Resistin is currently classified as experimental, with 5,635 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Resistin?

Resistin has a molecular weight of approximately 11419 g/mol.

Related peptides

Build on Resistin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key