Resistin-like beta

experimental

Also known as: Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELMbeta, RETNLB, Q9BQ08

Resistin-like beta (RELMβ), encoded by the *RETNLB* gene, is a cysteine-rich secreted protein predominantly expressed in the colon and small intestine. Its mechanism of action is not fully elucidated but is classified as a probable hormone, with evidence suggesting it functions as a signaling molecule in mucosal immunity and epithelial homeostasis. RELMβ is thought to modulate inflammatory responses by influencing macrophage activation and cytokine production, and it may also play a role in insulin resistance and energy metabolism, similar to its homolog resistin. The protein is secreted into the intestinal lumen and can act locally or systemically, though specific receptors and downstream pathways remain under investigation. Key research findings, based on limited experimental studies, indicate that RELMβ expression is upregulated in response to bacterial colonization, parasitic infection, and inflammatory stimuli in the gut. It has been implicated in promoting type 2 immune responses, including eosinophil recruitment and goblet cell hyperplasia, and may contribute to intestinal barrier function. Additionally, elevated RELMβ levels have been observed in colorectal carcinoma tissues, suggesting a potential role in tumorigenesis or cancer-associated inflammation. However, the small number of available studies (8 PubMed references) underscores the experimental nature of this research, with most data derived from animal models or in vitro systems. Clinically, RELMβ is not yet validated as a biomarker or therapeutic target. Its potential relevance lies in gastrointestinal inflammatory diseases (e.g., colitis), metabolic disorders, and colorectal cancer, but no human trials or diagnostic applications exist. The experimental status and limited evidence preclude any clinical recommendations. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Molecular weight
11730 g/mol
Research status
experimental
References
8
Tags
uniprot, disulfide-bond, hormone, reference-proteome, secreted, signal

Mechanism of action

Probable hormone

Research & studies

Resistin-like beta reduction is associated to low survival rate and is downregulated by adjuvant therapy in colorectal cancer patients
Scientific reports · 2023 · PubMed

RETNLB expression is significantly reduced in CRC biopsies compared to healthy mucosa.; Lower RETNLB levels correlate with higher TNM grade and older patient age.; Positive correlation between low RETNLB and mutations in KRAS, TP53, and BRAF.; Patients with poor 5-year prognosis and those receiving adjuvant therapy show lower RETNLB expression.

The Milk Active Ingredient, 2'-Fucosyllactose, Inhibits Inflammation and Promotes MUC2 Secretion in LS174T Goblet Cells In Vitro
Foods (Basel, Switzerland) · 2023 · PubMed
Deep Crypt Secretory Cell Differentiation in the Colonic Epithelium Is Regulated by Sprouty2 and Interleukin 13
Cellular and molecular gastroenterology and hepatology · 2023 · PubMed

Reg4+ DCS cell numbers doubled in distal colons of Spry2IE mice, with increased DCS marker expression.; Single-cell transcriptomics identified Retnlb/RELMβ as highly enriched in DCS cells, with increased expression in Spry2IE colons.; IL13, but not IL33, directly induced Reg4 and Retnlb expression in colonic organoids, and IL33-mediated DCS expansion required IL13 in vivo.; Loss of epithelial Sprouty2 activates type II innate lymphoid cells to release IL13, driving DCS cell expansion and elevated colonic RELMβ levels.

Investigating resistin like beta (RETNLB) as a tumor promoter for oral squamous cell carcinoma
Head & face medicine · 2021 · PubMed

RETNLB is overexpressed in oral squamous cell carcinoma tissues and cells.; High RETNLB expression is associated with advanced pathological tumor stage and poor patient survival.; Knockdown of RETNLB reduces cell viability, migration, and invasion.; RETNLB silencing suppresses TLR2, TLR4, and phospho-ERK protein levels.

Pyropia yezoensis glycoprotein promotes the M1 to M2 macrophage phenotypic switch via the STAT3 and STAT6 transcription factors
International journal of molecular medicine · 2016 · PubMed
Galectin-12 enhances inflammation by promoting M1 polarization of macrophages and reduces insulin sensitivity in adipocytes
Glycobiology · 2016 · PubMed
Opposing roles of nuclear receptor HNF4α isoforms in colitis and colitis-associated colon cancer
eLife · 2016 · PubMed
Glutathione peroxidase 2 and aquaporin 8 as new markers for colonic inflammation in experimental colitis and inflammatory bowel diseases: an important role for H2O2?
European journal of gastroenterology & hepatology · 2008 · PubMed

Frequently asked questions

What is Resistin-like beta?

Resistin-like beta (RELMβ), encoded by the *RETNLB* gene, is a cysteine-rich secreted protein predominantly expressed in the colon and small intestine. Its mechanism of action is not fully elucidated but is classified as a probable hormone, with evidence suggesting it functions as a signaling molecule in mucosal immuni

How does Resistin-like beta work?

Probable hormone

What is the research status of Resistin-like beta?

Resistin-like beta is currently classified as experimental, with 8 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Resistin-like beta?

Resistin-like beta has a molecular weight of approximately 11730 g/mol.

Related peptides

Build on Resistin-like beta data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key