Protein ADM2
experimentalAlso known as: Intermedin, ADM2, Q7Z4H4
**Mechanism of Action** Protein ADM2 (Intermedin) is a peptide hormone that exerts its biological effects primarily through activation of the calcitonin receptor-like receptor (CALCRL) in complex with receptor activity-modifying proteins (RAMPs). This receptor system mediates downstream signaling pathways involved in vasodilation, fluid homeostasis, and gastrointestinal motility. The peptide is structurally related to adrenomedullin and calcitonin gene-related peptide, sharing overlapping receptor interactions but with distinct tissue-specific actions. **Key Research Findings** Preclinical studies indicate that ADM2 modulates cardiovascular function by inducing hypotension and increasing cardiac output, likely via nitric oxide-dependent vasorelaxation. In gastrointestinal models, it regulates gastric emptying and intestinal fluid secretion. Despite its experimental status, no PubMed-indexed human or animal studies are currently available, suggesting limited published data. Research remains confined to early-stage characterization of its receptor pharmacology and physiological roles. **Clinical Relevance** ADM2 has potential therapeutic applications in conditions involving vascular dysregulation, such as hypertension or heart failure, and gastrointestinal disorders like motility dysfunction. However, its experimental designation and absence of peer-reviewed clinical evidence preclude any current medical use. Further studies are required to validate its safety, efficacy, and translational value. For research purposes only — not medical advice.
Key data
MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYGC15H25NO5Mechanism of action
Intermedin/ADM2 is a peptide hormone that plays a role as physiological regulator of gastrointestinal and cardiovascular bioactivities mediated by the CALCRL-RAMPs receptor complexes (PubMed:14615490). Activates the cAMP-dependent pathway through interaction with CALCRL-RAMP3 receptor complex (PubMed:14615490)
Frequently asked questions
What is Protein ADM2?
**Mechanism of Action** Protein ADM2 (Intermedin) is a peptide hormone that exerts its biological effects primarily through activation of the calcitonin receptor-like receptor (CALCRL) in complex with receptor activity-modifying proteins (RAMPs). This receptor system mediates downstream signaling pathways involved in v
How does Protein ADM2 work?
Intermedin/ADM2 is a peptide hormone that plays a role as physiological regulator of gastrointestinal and cardiovascular bioactivities mediated by the CALCRL-RAMPs receptor complexes (PubMed:14615490). Activates the cAMP-dependent pathway through interaction with CALCRL-RAMP3 receptor complex (PubMed:14615490)
What is the research status of Protein ADM2?
Protein ADM2 is currently classified as experimental. This is for research purposes only and is not medical advice.
What is the molecular weight of Protein ADM2?
Protein ADM2 has a molecular weight of approximately 299.36 g/mol (formula C15H25NO5).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Protein ADM2 data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key