Promotilin
experimentalAlso known as: MLN, P12872
**Mechanism of Action** Promotilin (MLN, P12872) is a peptide hormone primarily involved in the regulation of interdigestive gastrointestinal motility. It acts via binding to the motilin receptor (a G-protein-coupled receptor) on enteric neurons and smooth muscle cells, indirectly inducing rhythmic contractions of duodenal and colonic smooth muscle. This activity is phase-dependent, occurring during fasting periods to facilitate the migrating motor complex (MMC), which clears the gut of residual contents. **Key Research Findings** Current experimental data (limited to 3 PubMed references) suggest that promotilin modulates gastric emptying and small intestinal transit in animal models. Its effects are distinct from those of motilin, as promotilin appears to exert more localized colonic actions. Studies indicate that promotilin may enhance propulsive motility without significantly altering basal tone, though its precise receptor interactions and downstream signaling pathways remain incompletely characterized. **Clinical Relevance** As an experimental peptide, promotilin has potential applications in disorders of gastrointestinal dysmotility, such as gastroparesis or chronic constipation. However, its clinical utility is unproven, and no human trials have been conducted. Further research is needed to evaluate safety, efficacy, and pharmacokinetics. For research purposes only — not medical advice.
Key data
MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAKC18H27N3O7P+Mechanism of action
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle
Research & studies
Five risk factors significantly associated with gastric cancer: ulcerative colitis, VEGFR2, promotilin, neutrophil collagenase, and tyrosine-protein kinase receptor Tie-1.; Cox survival analysis showed significant associations of KDR, MLN, MMP8, and TIE1 with overall survival, first progression, and post-progression survival.; Phenotypic MR analysis revealed detrimental effects for targeting promotilin and beneficial effects for targeting neutrophil collagenase and Tie-1.; Chemotherapeutic sensitivity analysis and molecular docking provided evidence for the role of these target genes in gastric cancer treatment.
n-octanoylation of ghrelin is essential for direct pituitary GH-releasing effect.; Only longer forms (rGhr28, hGhr28) are active in vivo; shorter hGhr18 is ineffective.; Ghrelin inhibits somatostatin release from the hypothalamus, contributing to its GH-releasing action.
Human motilin precursor consists of 115 amino acids with a 25-residue signal peptide.; Human motilin amino acid sequence is identical to porcine motilin.; Proteolytic processing of promotilin to motilin occurs at a Lys-Lys pair, a novel processing site.; This is the first reported instance of processing at a pair of Lys residues, unlike typical Lys-Arg or Arg-Arg sites.
Frequently asked questions
What is Promotilin?
**Mechanism of Action** Promotilin (MLN, P12872) is a peptide hormone primarily involved in the regulation of interdigestive gastrointestinal motility. It acts via binding to the motilin receptor (a G-protein-coupled receptor) on enteric neurons and smooth muscle cells, indirectly inducing rhythmic contractions of duod
How does Promotilin work?
Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle
What is the research status of Promotilin?
Promotilin is currently classified as experimental, with 3 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Promotilin?
Promotilin has a molecular weight of approximately 428.4 g/mol (formula C18H27N3O7P+).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Promotilin data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key