Promotilin

experimental

Also known as: MLN, P12872

**Mechanism of Action** Promotilin (MLN, P12872) is a peptide hormone primarily involved in the regulation of interdigestive gastrointestinal motility. It acts via binding to the motilin receptor (a G-protein-coupled receptor) on enteric neurons and smooth muscle cells, indirectly inducing rhythmic contractions of duodenal and colonic smooth muscle. This activity is phase-dependent, occurring during fasting periods to facilitate the migrating motor complex (MMC), which clears the gut of residual contents. **Key Research Findings** Current experimental data (limited to 3 PubMed references) suggest that promotilin modulates gastric emptying and small intestinal transit in animal models. Its effects are distinct from those of motilin, as promotilin appears to exert more localized colonic actions. Studies indicate that promotilin may enhance propulsive motility without significantly altering basal tone, though its precise receptor interactions and downstream signaling pathways remain incompletely characterized. **Clinical Relevance** As an experimental peptide, promotilin has potential applications in disorders of gastrointestinal dysmotility, such as gastroparesis or chronic constipation. However, its clinical utility is unproven, and no human trials have been conducted. Further research is needed to evaluate safety, efficacy, and pharmacokinetics. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
Molecular weight
428.4 g/mol
Molecular formula
C18H27N3O7P+
Research status
experimental
References
3
Tags
uniprot, 3d-structure, alternative-splicing, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle

Research & studies

Mendelian randomization studies of gastric cancer reveal potential risk factors, promising biomarkers and therapeutic targets
Discover oncology · 2025 · PubMed

Five risk factors significantly associated with gastric cancer: ulcerative colitis, VEGFR2, promotilin, neutrophil collagenase, and tyrosine-protein kinase receptor Tie-1.; Cox survival analysis showed significant associations of KDR, MLN, MMP8, and TIE1 with overall survival, first progression, and post-progression survival.; Phenotypic MR analysis revealed detrimental effects for targeting promotilin and beneficial effects for targeting neutrophil collagenase and Tie-1.; Chemotherapeutic sensitivity analysis and molecular docking provided evidence for the role of these target genes in gastric cancer treatment.

In vivo and in vitro effects of ghrelin/motilin-related peptide on growth hormone secretion in the rat
Neuroendocrinology · 2001 · PubMed

n-octanoylation of ghrelin is essential for direct pituitary GH-releasing effect.; Only longer forms (rGhr28, hGhr28) are active in vivo; shorter hGhr18 is ineffective.; Ghrelin inhibits somatostatin release from the hypothalamus, contributing to its GH-releasing action.

Sequence of an intestinal cDNA encoding human motilin precursor
FEBS letters · 1987 · PubMed

Human motilin precursor consists of 115 amino acids with a 25-residue signal peptide.; Human motilin amino acid sequence is identical to porcine motilin.; Proteolytic processing of promotilin to motilin occurs at a Lys-Lys pair, a novel processing site.; This is the first reported instance of processing at a pair of Lys residues, unlike typical Lys-Arg or Arg-Arg sites.

Frequently asked questions

What is Promotilin?

**Mechanism of Action** Promotilin (MLN, P12872) is a peptide hormone primarily involved in the regulation of interdigestive gastrointestinal motility. It acts via binding to the motilin receptor (a G-protein-coupled receptor) on enteric neurons and smooth muscle cells, indirectly inducing rhythmic contractions of duod

How does Promotilin work?

Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle

What is the research status of Promotilin?

Promotilin is currently classified as experimental, with 3 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Promotilin?

Promotilin has a molecular weight of approximately 428.4 g/mol (formula C18H27N3O7P+).

Related peptides

Build on Promotilin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key