Progonadoliberin-1

approved

Also known as: Progonadoliberin I, GNRH1, P01148

Progonadoliberin-1, also known as gonadotropin-releasing hormone 1 (GNRH1), is a decapeptide encoded by the *GNRH1* gene (UniProt P01148). Its primary mechanism of action involves binding to the gonadotropin-releasing hormone receptor (GnRHR) on the anterior pituitary, thereby stimulating the synthesis and pulsatile secretion of both luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This pulsatile release is critical for normal reproductive function, as it regulates gonadal steroidogenesis and gametogenesis in both males and females. Key research findings confirm that Progonadoliberin-1 is the central hypothalamic regulator of the hypothalamic-pituitary-gonadal (HPG) axis. Approved for clinical use, synthetic analogs of this peptide (e.g., leuprolide, goserelin) are employed to either stimulate or suppress gonadotropin release, depending on the dosing regimen. Pulsatile administration is used to induce ovulation in hypogonadal infertility, while continuous administration leads to receptor desensitization and is utilized in treating hormone-sensitive cancers (e.g., prostate cancer) and conditions such as endometriosis and precocious puberty. Clinical relevance is well-established, with approved indications for assisted reproductive technology and hormone-dependent disorders. The peptide's therapeutic utility hinges on its ability to modulate the HPG axis, with extensive safety and efficacy data supporting its use. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Molecular weight
10380 g/mol
Research status
approved
References
2
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, disease-variant, hormone, hypogonadotropic-hypogonadism, kallmann-syndrome, pharmaceutical, proteomics-identification, pyrrolidone-carboxylic-acid

Mechanism of action

Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones

Research & studies

Isolated Gonadotropin-Releasing Hormone (GnRH) Deficiency
2022 · PubMed
Hormonal control of T-cell development in health and disease
Nature reviews. Endocrinology · 2016 · PubMed

Growth hormone and prolactin enhance thymocyte proliferation and migration.; Glucocorticoids induce apoptosis of developing thymocytes.; The thymus undergoes age-dependent atrophy, reducing T-cell generation and export.; Hormones like growth hormone and progonadoliberin-1 are used therapeutically for thymic atrophy in HIV infection.

Frequently asked questions

What is Progonadoliberin-1?

Progonadoliberin-1, also known as gonadotropin-releasing hormone 1 (GNRH1), is a decapeptide encoded by the *GNRH1* gene (UniProt P01148). Its primary mechanism of action involves binding to the gonadotropin-releasing hormone receptor (GnRHR) on the anterior pituitary, thereby stimulating the synthesis and pulsatile se

How does Progonadoliberin-1 work?

Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones

What is the research status of Progonadoliberin-1?

Progonadoliberin-1 is currently classified as approved, with 2 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Progonadoliberin-1?

Progonadoliberin-1 has a molecular weight of approximately 10380 g/mol.

Related peptides

Build on Progonadoliberin-1 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key