Pro-neuropeptide Y
experimentalAlso known as: NPY, P01303
Pro-neuropeptide Y (NPY, P01303) is a 97-amino acid precursor that is proteolytically processed to yield mature neuropeptide Y, a 36-amino acid neurotransmitter. Its primary mechanism of action involves binding to G-protein-coupled receptors, specifically neuropeptide Y receptor type 1 (Y1R) and type 2 (Y2R). Activation of these receptors modulates intracellular signaling cascades, including inhibition of adenylyl cyclase and regulation of calcium channels, leading to effects on appetite, energy homeostasis, stress response, and vasoconstriction. Current research on pro-neuropeptide Y is limited, with 17 PubMed references indicating an experimental status. Key findings have focused on its role in hypothalamic regulation of feeding behavior and energy balance, with studies showing that NPY signaling via Y1R and Y2R promotes food intake and reduces energy expenditure. Additionally, preclinical evidence suggests involvement in anxiety-like behaviors and cardiovascular modulation, though data remain preliminary. Clinical relevance is not yet established, as no approved therapeutic applications exist. The experimental nature of pro-neuropeptide Y research limits its translational potential, though its receptor pathways are considered targets for obesity, metabolic disorders, and stress-related conditions. Further studies are needed to clarify its physiological significance and therapeutic viability. For research purposes only — not medical advice.
Key data
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMWC190H287N55O57Mechanism of action
Ligand for neuropeptide Y receptor type 1 (NPY1R) and neuropeptide Y receptor type 2 (NPY2R) (PubMed:1321422, PubMed:7592910, PubMed:35165283, PubMed:35507650, PubMed:36525977, PubMed:38882210). Receptor binding induces adenylate cyclase-inhibiting G protein-coupled receptor signaling, resulting in inhibition of cAMP production (PubMed:1321422, PubMed:7592910, PubMed:38882210). Receptor activation by NPY also leads to an increase of intracellular Ca(2+) levels (PubMed:1321422, PubMed:35165283, PubMed:7592910). Is involved in the regulation of eating behaviour, acting as a stimulator of food intake (By similarity). Involved in the regulation of colonic antisecretory tone, and colonic contractility (By similarity)
Research & studies
Frequently asked questions
What is Pro-neuropeptide Y?
Pro-neuropeptide Y (NPY, P01303) is a 97-amino acid precursor that is proteolytically processed to yield mature neuropeptide Y, a 36-amino acid neurotransmitter. Its primary mechanism of action involves binding to G-protein-coupled receptors, specifically neuropeptide Y receptor type 1 (Y1R) and type 2 (Y2R). Activatio
How does Pro-neuropeptide Y work?
Ligand for neuropeptide Y receptor type 1 (NPY1R) and neuropeptide Y receptor type 2 (NPY2R) (PubMed:1321422, PubMed:7592910, PubMed:35165283, PubMed:35507650, PubMed:36525977, PubMed:38882210). Receptor binding induces adenylate cyclase-inhibiting G protein-coupled receptor signaling, resulting in inhibition of cAMP production (PubMed:1321422, PubMed:7592910, PubMed:38882210). Receptor activation
What is the research status of Pro-neuropeptide Y?
Pro-neuropeptide Y is currently classified as experimental, with 17 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Pro-neuropeptide Y?
Pro-neuropeptide Y has a molecular weight of approximately 4254 g/mol (formula C190H287N55O57).
Related peptides
CNTF-derived peptidergic compound that promotes neurogenesis and reduces tau pathology in preclinical Alzheimer's models.
33-aa hypothalamic neuropeptide acting on OX1/OX2 receptors to promote wakefulness and arousal.
Porcine brain-derived peptide preparation with neurotrophic-factor-like activity studied in stroke, TBI, and dementia.
Ligand for NPSR1 . Binds to its receptor with nanomolar affinity and initiates a G /GNAQ-dependent phospholipase C-activating signaling pathway. This results in Ca mobilization from intracellular stores and increased int…
NCAM-derived FG-loop peptide that activates FGFR1 to enhance synaptic plasticity and memory in animal models.
May function as an output molecule from the suprachiasmatic nucleus that transmits behavioral circadian rhythm.
Build on Pro-neuropeptide Y data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key