Pro-neuropeptide Y

experimental

Also known as: NPY, P01303

Pro-neuropeptide Y (NPY, P01303) is a 97-amino acid precursor that is proteolytically processed to yield mature neuropeptide Y, a 36-amino acid neurotransmitter. Its primary mechanism of action involves binding to G-protein-coupled receptors, specifically neuropeptide Y receptor type 1 (Y1R) and type 2 (Y2R). Activation of these receptors modulates intracellular signaling cascades, including inhibition of adenylyl cyclase and regulation of calcium channels, leading to effects on appetite, energy homeostasis, stress response, and vasoconstriction. Current research on pro-neuropeptide Y is limited, with 17 PubMed references indicating an experimental status. Key findings have focused on its role in hypothalamic regulation of feeding behavior and energy balance, with studies showing that NPY signaling via Y1R and Y2R promotes food intake and reduces energy expenditure. Additionally, preclinical evidence suggests involvement in anxiety-like behaviors and cardiovascular modulation, though data remain preliminary. Clinical relevance is not yet established, as no approved therapeutic applications exist. The experimental nature of pro-neuropeptide Y research limits its translational potential, though its receptor pathways are considered targets for obesity, metabolic disorders, and stress-related conditions. Further studies are needed to clarify its physiological significance and therapeutic viability. For research purposes only — not medical advice.

Key data

Category
Cognitive & Neuroprotective
Sequence
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Molecular weight
4254 g/mol
Molecular formula
C190H287N55O57
CAS number
82785-45-3
Research status
experimental
References
17
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, cytoplasmic-vesicle, neuropeptide, phosphoprotein, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Ligand for neuropeptide Y receptor type 1 (NPY1R) and neuropeptide Y receptor type 2 (NPY2R) (PubMed:1321422, PubMed:7592910, PubMed:35165283, PubMed:35507650, PubMed:36525977, PubMed:38882210). Receptor binding induces adenylate cyclase-inhibiting G protein-coupled receptor signaling, resulting in inhibition of cAMP production (PubMed:1321422, PubMed:7592910, PubMed:38882210). Receptor activation by NPY also leads to an increase of intracellular Ca(2+) levels (PubMed:1321422, PubMed:35165283, PubMed:7592910). Is involved in the regulation of eating behaviour, acting as a stimulator of food intake (By similarity). Involved in the regulation of colonic antisecretory tone, and colonic contractility (By similarity)

Research & studies

Pancreatic Cancer Detection and Differentiation from Chronic Pancreatitis: Potential Biomarkers Identified through a High-Throughput Multiplex Proteomic Assay and Machine Learning-Based Analysis
Annals of laboratory medicine · 2025 · PubMed
Neuropeptide Y and Derivates Are Not Ready for Prime Time in Prostate Cancer Early Detection
European urology open science · 2024 · PubMed
A differential proteomics study of cerebrospinal fluid from individuals with Niemann-Pick disease, Type C1
Proteomics · 2023 · PubMed
Predictive value of combined analysis of pro-NPY and ERG in localized prostate cancer
APMIS : acta pathologica, microbiologica, et immunologica Scandinavica · 2018 · PubMed
Cerebrospinal fluid prohormone processing and neuropeptides stimulating feed intake of dairy cows during early lactation
Journal of proteome research · 2015 · PubMed
Biosynthesis of peptide hormones derived from precursor sequences
Current medicinal chemistry · 2004 · PubMed
Semisynthesis and characterization of the first analogues of pro-neuropeptide y
Chembiochem : a European journal of chemical biology · 2003 · PubMed
No leucine(7)-to-proline(7) polymorphism in the signal peptide of neuropeptide Y in Japanese population or Japanese with alcoholism
Psychiatric genetics · 2001 · PubMed

Frequently asked questions

What is Pro-neuropeptide Y?

Pro-neuropeptide Y (NPY, P01303) is a 97-amino acid precursor that is proteolytically processed to yield mature neuropeptide Y, a 36-amino acid neurotransmitter. Its primary mechanism of action involves binding to G-protein-coupled receptors, specifically neuropeptide Y receptor type 1 (Y1R) and type 2 (Y2R). Activatio

How does Pro-neuropeptide Y work?

Ligand for neuropeptide Y receptor type 1 (NPY1R) and neuropeptide Y receptor type 2 (NPY2R) (PubMed:1321422, PubMed:7592910, PubMed:35165283, PubMed:35507650, PubMed:36525977, PubMed:38882210). Receptor binding induces adenylate cyclase-inhibiting G protein-coupled receptor signaling, resulting in inhibition of cAMP production (PubMed:1321422, PubMed:7592910, PubMed:38882210). Receptor activation

What is the research status of Pro-neuropeptide Y?

Pro-neuropeptide Y is currently classified as experimental, with 17 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Pro-neuropeptide Y?

Pro-neuropeptide Y has a molecular weight of approximately 4254 g/mol (formula C190H287N55O57).

Related peptides

Build on Pro-neuropeptide Y data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key