Pro-FMRFamide-related neuropeptide FF

experimental

Also known as: FMRFamide-related peptides, NPFF, O15130

Pro-FMRFamide-related neuropeptide FF (NPFF) is a precursor protein that gives rise to several bioactive peptides, including neuropeptide FF (NPFF) and neuropeptide AF (NPAF). These peptides are primarily known for their role in modulating opioid-induced analgesia, acting as endogenous anti-opioid agents. The mechanism involves binding to specific G-protein-coupled receptors, NPFF1 and NPFF2, which are widely distributed in the central nervous system. Activation of these receptors can counteract morphine-induced analgesia, elevate arterial blood pressure, and stimulate somatostatin secretion from the pancreas, indicating a broad range of physiological effects beyond pain modulation. Key research findings indicate that NPFF and related peptides can both enhance and inhibit opioid effects depending on the dose, route of administration, and receptor subtype involved. For example, low doses may potentiate morphine analgesia, while higher doses reverse it. Additionally, NPFF has been implicated in cardiovascular regulation, with studies showing its ability to increase blood pressure via central and peripheral mechanisms. The peptide also influences neuroendocrine function, particularly by promoting somatostatin release, which may affect glucose homeostasis and gastrointestinal activity. Clinically, NPFF and its analogs are of interest for developing novel analgesics and treatments for opioid tolerance and dependence. However, due to its complex, dose-dependent effects on pain and cardiovascular systems, therapeutic applications remain experimental. Further research is needed to clarify receptor-specific actions and potential side effects before clinical translation. For research purposes only — not medical advice.

Key data

Category
Cognitive & Neuroprotective
Sequence
MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
Molecular weight
1081.3 g/mol
Molecular formula
C54H76N14O10
CAS number
99566-27-5
Research status
experimental
Tags
uniprot, 3d-structure, alternative-splicing, amidation, cleavage-on-pair-of-basic-residues, neuropeptide, reference-proteome, secreted, signal

Mechanism of action

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels

Frequently asked questions

What is Pro-FMRFamide-related neuropeptide FF?

Pro-FMRFamide-related neuropeptide FF (NPFF) is a precursor protein that gives rise to several bioactive peptides, including neuropeptide FF (NPFF) and neuropeptide AF (NPAF). These peptides are primarily known for their role in modulating opioid-induced analgesia, acting as endogenous anti-opioid agents. The mechanism

How does Pro-FMRFamide-related neuropeptide FF work?

Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels

What is the research status of Pro-FMRFamide-related neuropeptide FF?

Pro-FMRFamide-related neuropeptide FF is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Pro-FMRFamide-related neuropeptide FF?

Pro-FMRFamide-related neuropeptide FF has a molecular weight of approximately 1081.3 g/mol (formula C54H76N14O10).

Related peptides

Build on Pro-FMRFamide-related neuropeptide FF data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key