Pro-FMRFamide-related neuropeptide FF
experimentalAlso known as: FMRFamide-related peptides, NPFF, O15130
Pro-FMRFamide-related neuropeptide FF (NPFF) is a precursor protein that gives rise to several bioactive peptides, including neuropeptide FF (NPFF) and neuropeptide AF (NPAF). These peptides are primarily known for their role in modulating opioid-induced analgesia, acting as endogenous anti-opioid agents. The mechanism involves binding to specific G-protein-coupled receptors, NPFF1 and NPFF2, which are widely distributed in the central nervous system. Activation of these receptors can counteract morphine-induced analgesia, elevate arterial blood pressure, and stimulate somatostatin secretion from the pancreas, indicating a broad range of physiological effects beyond pain modulation. Key research findings indicate that NPFF and related peptides can both enhance and inhibit opioid effects depending on the dose, route of administration, and receptor subtype involved. For example, low doses may potentiate morphine analgesia, while higher doses reverse it. Additionally, NPFF has been implicated in cardiovascular regulation, with studies showing its ability to increase blood pressure via central and peripheral mechanisms. The peptide also influences neuroendocrine function, particularly by promoting somatostatin release, which may affect glucose homeostasis and gastrointestinal activity. Clinically, NPFF and its analogs are of interest for developing novel analgesics and treatments for opioid tolerance and dependence. However, due to its complex, dose-dependent effects on pain and cardiovascular systems, therapeutic applications remain experimental. Further research is needed to clarify receptor-specific actions and potential side effects before clinical translation. For research purposes only — not medical advice.
Key data
MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKKC54H76N14O10Mechanism of action
Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels
Frequently asked questions
What is Pro-FMRFamide-related neuropeptide FF?
Pro-FMRFamide-related neuropeptide FF (NPFF) is a precursor protein that gives rise to several bioactive peptides, including neuropeptide FF (NPFF) and neuropeptide AF (NPAF). These peptides are primarily known for their role in modulating opioid-induced analgesia, acting as endogenous anti-opioid agents. The mechanism
How does Pro-FMRFamide-related neuropeptide FF work?
Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels
What is the research status of Pro-FMRFamide-related neuropeptide FF?
Pro-FMRFamide-related neuropeptide FF is currently classified as experimental. This is for research purposes only and is not medical advice.
What is the molecular weight of Pro-FMRFamide-related neuropeptide FF?
Pro-FMRFamide-related neuropeptide FF has a molecular weight of approximately 1081.3 g/mol (formula C54H76N14O10).
Related peptides
CNTF-derived peptidergic compound that promotes neurogenesis and reduces tau pathology in preclinical Alzheimer's models.
33-aa hypothalamic neuropeptide acting on OX1/OX2 receptors to promote wakefulness and arousal.
Porcine brain-derived peptide preparation with neurotrophic-factor-like activity studied in stroke, TBI, and dementia.
Ligand for NPSR1 . Binds to its receptor with nanomolar affinity and initiates a G /GNAQ-dependent phospholipase C-activating signaling pathway. This results in Ca mobilization from intracellular stores and increased int…
NCAM-derived FG-loop peptide that activates FGFR1 to enhance synaptic plasticity and memory in animal models.
May function as an output molecule from the suprachiasmatic nucleus that transmits behavioral circadian rhythm.
Build on Pro-FMRFamide-related neuropeptide FF data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key