Oxytocin-neurophysin 1 proprotein

approved

Also known as: pro-oxytocin/neurophysin, OXT, P01178

Precursor of oxytocin, a neurohypophyseal hormone that plays a key role in social interactions and neurophysin 1, its carrier protein

Key data

Category
Hormonal & Endocrine
Sequence
MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Molecular weight
12722 g/mol
Research status
approved
Tags
uniprot, 3d-structure, amidation, behavior, cleavage-on-pair-of-basic-residues, cytoplasmic-vesicle, direct-protein-sequencing, disulfide-bond, hormone, pharmaceutical, proteomics-identification, reference-proteome

Frequently asked questions

What is Oxytocin-neurophysin 1 proprotein?

Precursor of oxytocin, a neurohypophyseal hormone that plays a key role in social interactions and neurophysin 1, its carrier protein

How does Oxytocin-neurophysin 1 proprotein work?

Precursor of oxytocin, a neurohypophyseal hormone that plays a key role in social interactions and neurophysin 1, its carrier protein

What is the research status of Oxytocin-neurophysin 1 proprotein?

Oxytocin-neurophysin 1 proprotein is currently classified as approved. This is for research purposes only and is not medical advice.

What is the molecular weight of Oxytocin-neurophysin 1 proprotein?

Oxytocin-neurophysin 1 proprotein has a molecular weight of approximately 12722 g/mol.

Related peptides

Build on Oxytocin-neurophysin 1 proprotein data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key