Osteocrin

experimental

Also known as: Musclin, OSTN, P61366

Osteocrin (also known as Musclin, OSTN, P61366) is a secreted peptide hormone primarily expressed in bone and skeletal muscle, with emerging roles in neuronal development. Its mechanism of action involves binding to natriuretic peptide receptor C (NPR-C), thereby modulating cGMP signaling pathways. In the developing cerebral cortex, Osteocrin acts as a negative regulator of dendritic growth, limiting the expansion of dendritic arbors in response to sensory experience. This activity is mediated through the suppression of the cGMP-dependent protein kinase pathway, which fine-tunes neuronal connectivity during critical periods of cortical plasticity. Key research findings demonstrate that Osteocrin expression in the cortex is activity-dependent, increasing with sensory stimulation and peaking during early postnatal development. Knockout studies in mice show that loss of Osteocrin leads to excessive dendritic arborization and altered synaptic connectivity, while overexpression restricts dendritic growth. These effects are specific to cortical neurons and are not observed in other brain regions, highlighting its role in experience-dependent cortical maturation. Additionally, Osteocrin has been implicated in bone metabolism and muscle physiology, where it regulates osteoblast differentiation and glucose uptake, though its neuronal functions remain the primary focus of current research. Clinically, Osteocrin’s role in dendritic plasticity suggests potential relevance for neurodevelopmental disorders characterized by aberrant connectivity, such as autism spectrum disorders or intellectual disability. However, its experimental status limits direct therapeutic applications. Further studies are needed to clarify its signaling specificity and long-term effects on neural circuit function. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Molecular weight
14722 g/mol
Research status
experimental
References
53
Tags
uniprot, amidation, cleavage-on-pair-of-basic-residues, developmental-protein, differentiation, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Hormone that acts as a regulator of dendritic growth in the developing cerebral cortex in response to sensory experience (PubMed:27830782). Induced in the brain following membrane depolarization and inhibits dendritic branching in neurons of the developing cortex (PubMed:27830782). Probably acts by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production (By similarity)

Research & studies

miR-320-3p regulates apelin and TGF-β/SMAD3 signaling in hypobaric hypoxia exposed rats to induce skeletal muscle atrophy
Journal of physiology and biochemistry · 2025 · PubMed
The pivotal role of the Hes1/Piezo1 pathway in the pathophysiology of glucocorticoid-induced osteoporosis
JCI insight · 2024 · PubMed

Piezo1 expression is reduced in cortical bone osteocytes of GIOP patients and mouse models.; Yoda1, a Piezo1 agonist, enhances mechanical stress response and bone mass/strength in GIOP mice.; Yoda1 activates the Hes1 transcription factor, leading to increased CaM kinase II and Akt phosphorylation in osteocytes.; Yoda1 rescues dexamethasone-suppressed osteoblast differentiation in human periosteum-derived cells.

Haemodynamic, hormonal and renal actions of osteocrin in normal sheep
Experimental physiology · 2024 · PubMed

Osteocrin increased plasma levels of ANP, BNP, CNP, and cGMP in a dose-dependent manner.; Increases in plasma cGMP were associated with progressive reductions in arterial pressure and central venous pressure.; Osteocrin administration did not cause natriuresis or diuresis in normal sheep.; Plasma cAMP, renin, and aldosterone levels remained unchanged.

Osteocrin/musclin and the natriuretic peptides system: A novel focus in metabolism and cardiovascular prevention
Experimental physiology · 2024 · PubMed
Effects of exercise or metformin on myokine concentrations in patients with breast and colorectal cancer: A phase II multi-centre factorial randomized trial
Journal of cachexia, sarcopenia and muscle · 2024 · PubMed
The natriuretic peptide receptor agonist osteocrin disperses Pseudomonas aeruginosa biofilm
Biofilm · 2023 · PubMed
Partial prevention of glucocorticoid-induced osteocyte deterioration in young male mice with osteocrin gene therapy
iScience · 2022 · PubMed
Osteocrin ameliorates adriamycin nephropathy via p38 mitogen-activated protein kinase inhibition
Scientific reports · 2021 · PubMed

Frequently asked questions

What is Osteocrin?

Osteocrin (also known as Musclin, OSTN, P61366) is a secreted peptide hormone primarily expressed in bone and skeletal muscle, with emerging roles in neuronal development. Its mechanism of action involves binding to natriuretic peptide receptor C (NPR-C), thereby modulating cGMP signaling pathways. In the developing ce

How does Osteocrin work?

Hormone that acts as a regulator of dendritic growth in the developing cerebral cortex in response to sensory experience (PubMed:27830782). Induced in the brain following membrane depolarization and inhibits dendritic branching in neurons of the developing cortex (PubMed:27830782). Probably acts by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C an

What is the research status of Osteocrin?

Osteocrin is currently classified as experimental, with 53 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Osteocrin?

Osteocrin has a molecular weight of approximately 14722 g/mol.

Related peptides

Build on Osteocrin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key