Orexigenic neuropeptide QRFP
experimentalAlso known as: P518, QRFP, P83859
**Mechanism of Action** Orexigenic neuropeptide QRFP (P518, P83859) is a hypothalamic peptide that binds to the G-protein-coupled receptor GPR103 (also known as QRFP receptor). Activation of this receptor stimulates intracellular calcium mobilization and downstream signaling pathways that promote orexigenic (appetite-stimulating) effects. QRFP also modulates autonomic nervous system activity, leading to increased metabolic rate, locomotor activity, and blood pressure, likely through central and peripheral mechanisms involving sympathetic outflow. **Key Research Findings** Preclinical studies demonstrate that central administration of QRFP in rodents robustly increases food intake, body weight gain, and energy expenditure. The peptide also elevates locomotor activity and mean arterial pressure, suggesting a dual role in energy homeostasis and cardiovascular regulation. However, the experimental status of QRFP indicates that its physiological significance and therapeutic potential remain under investigation, with no published human trials or validated clinical applications to date. **Clinical Relevance** QRFP’s orexigenic and pressor effects position it as a potential target for disorders involving appetite dysregulation (e.g., cachexia, anorexia) or metabolic dysfunction. Conversely, its hypertensive properties raise safety concerns for therapeutic use. Current evidence is limited to animal models, and no clinical data support its application in humans. For research purposes only — not medical advice.
Key data
MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRRC127H195N37O37Mechanism of action
Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland (By similarity)
Frequently asked questions
What is Orexigenic neuropeptide QRFP?
**Mechanism of Action** Orexigenic neuropeptide QRFP (P518, P83859) is a hypothalamic peptide that binds to the G-protein-coupled receptor GPR103 (also known as QRFP receptor). Activation of this receptor stimulates intracellular calcium mobilization and downstream signaling pathways that promote orexigenic (appetite-s
How does Orexigenic neuropeptide QRFP work?
Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland (By similarity)
What is the research status of Orexigenic neuropeptide QRFP?
Orexigenic neuropeptide QRFP is currently classified as experimental. This is for research purposes only and is not medical advice.
What is the molecular weight of Orexigenic neuropeptide QRFP?
Orexigenic neuropeptide QRFP has a molecular weight of approximately 2832.1 g/mol (formula C127H195N37O37).
Related peptides
CNTF-derived peptidergic compound that promotes neurogenesis and reduces tau pathology in preclinical Alzheimer's models.
33-aa hypothalamic neuropeptide acting on OX1/OX2 receptors to promote wakefulness and arousal.
Porcine brain-derived peptide preparation with neurotrophic-factor-like activity studied in stroke, TBI, and dementia.
Ligand for NPSR1 . Binds to its receptor with nanomolar affinity and initiates a G /GNAQ-dependent phospholipase C-activating signaling pathway. This results in Ca mobilization from intracellular stores and increased int…
NCAM-derived FG-loop peptide that activates FGFR1 to enhance synaptic plasticity and memory in animal models.
May function as an output molecule from the suprachiasmatic nucleus that transmits behavioral circadian rhythm.
Build on Orexigenic neuropeptide QRFP data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key