Orexigenic neuropeptide QRFP

experimental

Also known as: P518, QRFP, P83859

**Mechanism of Action** Orexigenic neuropeptide QRFP (P518, P83859) is a hypothalamic peptide that binds to the G-protein-coupled receptor GPR103 (also known as QRFP receptor). Activation of this receptor stimulates intracellular calcium mobilization and downstream signaling pathways that promote orexigenic (appetite-stimulating) effects. QRFP also modulates autonomic nervous system activity, leading to increased metabolic rate, locomotor activity, and blood pressure, likely through central and peripheral mechanisms involving sympathetic outflow. **Key Research Findings** Preclinical studies demonstrate that central administration of QRFP in rodents robustly increases food intake, body weight gain, and energy expenditure. The peptide also elevates locomotor activity and mean arterial pressure, suggesting a dual role in energy homeostasis and cardiovascular regulation. However, the experimental status of QRFP indicates that its physiological significance and therapeutic potential remain under investigation, with no published human trials or validated clinical applications to date. **Clinical Relevance** QRFP’s orexigenic and pressor effects position it as a potential target for disorders involving appetite dysregulation (e.g., cachexia, anorexia) or metabolic dysfunction. Conversely, its hypertensive properties raise safety concerns for therapeutic use. Current evidence is limited to animal models, and no clinical data support its application in humans. For research purposes only — not medical advice.

Key data

Category
Cognitive & Neuroprotective
Sequence
MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR
Molecular weight
2832.1 g/mol
Molecular formula
C127H195N37O37
Research status
experimental
Tags
uniprot, 3d-structure, amidation, neuropeptide, pyrrolidone-carboxylic-acid, reference-proteome, secreted, signal

Mechanism of action

Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland (By similarity)

Frequently asked questions

What is Orexigenic neuropeptide QRFP?

**Mechanism of Action** Orexigenic neuropeptide QRFP (P518, P83859) is a hypothalamic peptide that binds to the G-protein-coupled receptor GPR103 (also known as QRFP receptor). Activation of this receptor stimulates intracellular calcium mobilization and downstream signaling pathways that promote orexigenic (appetite-s

How does Orexigenic neuropeptide QRFP work?

Stimulates feeding behavior, metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland (By similarity)

What is the research status of Orexigenic neuropeptide QRFP?

Orexigenic neuropeptide QRFP is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Orexigenic neuropeptide QRFP?

Orexigenic neuropeptide QRFP has a molecular weight of approximately 2832.1 g/mol (formula C127H195N37O37).

Related peptides

Build on Orexigenic neuropeptide QRFP data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key