Natriuretic peptides B

approved

Also known as: Brain natriuretic factor prohormone, Gamma-brain natriuretic peptide, Iso-ANP, NPPB, P16860

**Mechanism of Action** Natriuretic peptide B (BNP), encoded by the *NPPB* gene, is a cardiac hormone primarily secreted by ventricular myocytes in response to wall stretch and volume overload. It binds to natriuretic peptide receptor A (NPR-A), activating guanylyl cyclase to increase intracellular cGMP. This signaling cascade promotes natriuresis, vasodilation, and inhibition of the renin-angiotensin-aldosterone system (RAAS), thereby reducing blood pressure and cardiac preload. The prohormone (proBNP) is cleaved into the biologically active BNP and the inactive N-terminal fragment (NT-proBNP), both of which are clinically measured. **Key Research Findings** Elevated BNP and NT-proBNP levels are established biomarkers for heart failure (HF) diagnosis, severity stratification, and prognosis. Studies demonstrate that BNP-guided therapy improves outcomes in chronic HF by optimizing diuretic and vasodilator dosing. Synthetic BNP (nesiritide) was approved for acute decompensated HF, though meta-analyses show modest benefits in symptom relief without significant mortality reduction. Research also links BNP to renal function modulation, with higher levels correlating with glomerular filtration rate decline in cardiorenal syndrome. **Clinical Relevance** BNP testing is standard in emergency and outpatient settings to differentiate dyspnea of cardiac vs. pulmonary origin. NT-proBNP is preferred for long-term monitoring due to its longer half-life. Despite approval, synthetic BNP use has declined due to hypotension risks and lack of survival benefit. Ongoing studies explore BNP analogs with improved pharmacokinetics and tissue selectivity. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Molecular weight
300.31 g/mol
Molecular formula
C16H16N2O4
CAS number
107254-86-4
Research status
approved
References
30
Tags
uniprot, 3d-structure, direct-protein-sequencing, disulfide-bond, glycoprotein, hormone, pharmaceutical, proteoglycan, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:1672777, PubMed:17372040, PubMed:1914098, PubMed:9458824). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed:1672777, PubMed:17349887, PubMed:17372040, PubMed:21098034, PubMed:25339504, PubMed:9458824). Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion (PubMed:1914098, PubMed:9458824). Binds the clearance receptor NPR3 (PubMed:16870210)

Research & studies

Impact of malnutrition in patients with severe heart failure
European journal of heart failure · 2024 · PubMed
Unveiling the Role of Biomarkers in Cardiovascular Risk Assessment and Prognosis
Cureus · 2024 · PubMed

Biomarkers representing diverse pathophysiological pathways can enhance cardiovascular risk stratification.; Established biomarkers include troponins, natriuretic peptides, and lipid profiles.; Emerging biomarkers such as microRNAs and inflammatory markers are being examined.; Natriuretic peptides (BNP, NT-proBNP) and cardiac troponins (TnI, TnT) are useful for heart failure risk and prognosis.

Biomarkers for the Diagnosis of Heart Failure in People with Diabetes: A Consensus Report from Diabetes Technology Society
Progress in cardiovascular diseases · 2023 · PubMed
Effects and safety of natriuretic peptides as treatment of cirrhotic ascites: A systematic review and meta-analysis
World journal of hepatology · 2022 · PubMed
Biomarkers in heart failure: the past, current and future
Heart failure reviews · 2019 · PubMed
ANMCO/ELAS/SIBioC Consensus Document: biomarkers in heart failure
European heart journal supplements : journal of the European Society of Cardiology · 2017 · PubMed
B-type natriuretic peptides help in cardioembolic stroke diagnosis: pooled data meta-analysis
Stroke · 2015 · PubMed

BNP/NT-proBNP levels are significantly elevated in cardioembolic stroke within 72 hours of symptom onset.; Adding BNP/NT-proBNP to clinical models improved sensitivity (>90%) and specificity (>80%) for identifying cardioembolic stroke.; Both peptides significantly increased area under the curve and integrated discrimination improvement index compared to clinical models alone.; Findings were validated in 197 patients with initially undetermined stroke after ancillary follow-up.

The diagnostic accuracy of the natriuretic peptides in heart failure: systematic review and diagnostic meta-analysis in the acute care setting
BMJ (Clinical research ed.) · 2015 · PubMed

Frequently asked questions

What is Natriuretic peptides B?

**Mechanism of Action** Natriuretic peptide B (BNP), encoded by the *NPPB* gene, is a cardiac hormone primarily secreted by ventricular myocytes in response to wall stretch and volume overload. It binds to natriuretic peptide receptor A (NPR-A), activating guanylyl cyclase to increase intracellular cGMP. This signaling

How does Natriuretic peptides B work?

Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:1672777, PubMed:17372040, PubMed:1914098, PubMed:9458824). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed:1672777, PubMed:1

What is the research status of Natriuretic peptides B?

Natriuretic peptides B is currently classified as approved, with 30 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Natriuretic peptides B?

Natriuretic peptides B has a molecular weight of approximately 300.31 g/mol (formula C16H16N2O4).

Related peptides

Build on Natriuretic peptides B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key