Natriuretic peptides B
approvedAlso known as: Brain natriuretic factor prohormone, Gamma-brain natriuretic peptide, Iso-ANP, NPPB, P16860
**Mechanism of Action** Natriuretic peptide B (BNP), encoded by the *NPPB* gene, is a cardiac hormone primarily secreted by ventricular myocytes in response to wall stretch and volume overload. It binds to natriuretic peptide receptor A (NPR-A), activating guanylyl cyclase to increase intracellular cGMP. This signaling cascade promotes natriuresis, vasodilation, and inhibition of the renin-angiotensin-aldosterone system (RAAS), thereby reducing blood pressure and cardiac preload. The prohormone (proBNP) is cleaved into the biologically active BNP and the inactive N-terminal fragment (NT-proBNP), both of which are clinically measured. **Key Research Findings** Elevated BNP and NT-proBNP levels are established biomarkers for heart failure (HF) diagnosis, severity stratification, and prognosis. Studies demonstrate that BNP-guided therapy improves outcomes in chronic HF by optimizing diuretic and vasodilator dosing. Synthetic BNP (nesiritide) was approved for acute decompensated HF, though meta-analyses show modest benefits in symptom relief without significant mortality reduction. Research also links BNP to renal function modulation, with higher levels correlating with glomerular filtration rate decline in cardiorenal syndrome. **Clinical Relevance** BNP testing is standard in emergency and outpatient settings to differentiate dyspnea of cardiac vs. pulmonary origin. NT-proBNP is preferred for long-term monitoring due to its longer half-life. Despite approval, synthetic BNP use has declined due to hypotension risks and lack of survival benefit. Ongoing studies explore BNP analogs with improved pharmacokinetics and tissue selectivity. For research purposes only — not medical advice.
Key data
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHC16H16N2O4Mechanism of action
Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:1672777, PubMed:17372040, PubMed:1914098, PubMed:9458824). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed:1672777, PubMed:17349887, PubMed:17372040, PubMed:21098034, PubMed:25339504, PubMed:9458824). Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion (PubMed:1914098, PubMed:9458824). Binds the clearance receptor NPR3 (PubMed:16870210)
Research & studies
Biomarkers representing diverse pathophysiological pathways can enhance cardiovascular risk stratification.; Established biomarkers include troponins, natriuretic peptides, and lipid profiles.; Emerging biomarkers such as microRNAs and inflammatory markers are being examined.; Natriuretic peptides (BNP, NT-proBNP) and cardiac troponins (TnI, TnT) are useful for heart failure risk and prognosis.
BNP/NT-proBNP levels are significantly elevated in cardioembolic stroke within 72 hours of symptom onset.; Adding BNP/NT-proBNP to clinical models improved sensitivity (>90%) and specificity (>80%) for identifying cardioembolic stroke.; Both peptides significantly increased area under the curve and integrated discrimination improvement index compared to clinical models alone.; Findings were validated in 197 patients with initially undetermined stroke after ancillary follow-up.
Frequently asked questions
What is Natriuretic peptides B?
**Mechanism of Action** Natriuretic peptide B (BNP), encoded by the *NPPB* gene, is a cardiac hormone primarily secreted by ventricular myocytes in response to wall stretch and volume overload. It binds to natriuretic peptide receptor A (NPR-A), activating guanylyl cyclase to increase intracellular cGMP. This signaling
How does Natriuretic peptides B work?
Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:1672777, PubMed:17372040, PubMed:1914098, PubMed:9458824). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed:1672777, PubMed:1
What is the research status of Natriuretic peptides B?
Natriuretic peptides B is currently classified as approved, with 30 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Natriuretic peptides B?
Natriuretic peptides B has a molecular weight of approximately 300.31 g/mol (formula C16H16N2O4).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Natriuretic peptides B data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key