Lutropin subunit beta

experimental

Also known as: Luteinizing hormone subunit beta, LHB, P01229

Lutropin subunit beta (LHB) is the beta chain of luteinizing hormone (LH), a heterodimeric glycoprotein essential for reproductive function. Its mechanism of action involves binding to the LH/choriogonadotropin receptor (LHCGR) on gonadal cells, activating G-protein-coupled signaling pathways that upregulate steroidogenic enzymes. In males, this stimulates Leydig cells to produce testosterone, supporting spermatogenesis; in females, it triggers ovulation and promotes luteal phase progesterone synthesis. The beta subunit confers receptor specificity and biological activity, distinguishing LH from follicle-stimulating hormone. Current research on LHB remains experimental, with limited PubMed-indexed studies (2 references). Key findings focus on its structural role in LH function and potential implications in reproductive disorders, such as hypogonadotropic hypogonadism or infertility. No clinical trials or therapeutic applications have been established, and its use as a standalone peptide is not validated. The experimental status underscores the need for further investigation into its pharmacokinetics, safety, and efficacy. Clinical relevance is confined to basic science contexts, where LHB serves as a model for studying gonadotropin biology and receptor interactions. It is not approved for human use, and no evidence supports its application in fertility treatments or hormone replacement therapy. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Molecular weight
433.4 g/mol
Molecular formula
C17H23N9O5
Research status
experimental
References
2
Tags
uniprot, direct-protein-sequencing, disease-variant, disulfide-bond, glycoprotein, hormone, hypogonadotropic-hypogonadism, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids

Research & studies

Application of a Multiplex Platform to Identify Novel Biomarkers for Pregnancy Location and Viability
Reproductive sciences (Thousand Oaks, Calif.) · 2023 · PubMed

For pregnancy location, 18 markers had AUC ≥ 0.80; three (thyrotropin subunit beta, carbonic anhydrase 3, DEAD box polypeptide 58) were elevated in ectopic pregnancies.; For pregnancy viability, two markers (lutropin subunit beta, serpin B8) had AUC ≥ 0.80.; Some identified biomarkers were from pathways not previously explored in early pregnancy physiology.

Application of a Multiplex Platform to Identify Novel Biomarkers for Pregnancy Location and Viability
Research square · 2023 · PubMed

18 biomarkers for pregnancy location had AUC ≥ 0.80, including thyrotropin subunit beta, carbonic anhydrase 3, and DEAD box polypeptide 58.; Two biomarkers for pregnancy viability had AUC ≥ 0.80: lutropin subunit beta and serpin B8.; Some identified markers are from pathways not previously explored in early pregnancy physiology.; Twenty candidate biomarkers were identified for further validation as diagnostic tools.

Frequently asked questions

What is Lutropin subunit beta?

Lutropin subunit beta (LHB) is the beta chain of luteinizing hormone (LH), a heterodimeric glycoprotein essential for reproductive function. Its mechanism of action involves binding to the LH/choriogonadotropin receptor (LHCGR) on gonadal cells, activating G-protein-coupled signaling pathways that upregulate steroidoge

How does Lutropin subunit beta work?

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids

What is the research status of Lutropin subunit beta?

Lutropin subunit beta is currently classified as experimental, with 2 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Lutropin subunit beta?

Lutropin subunit beta has a molecular weight of approximately 433.4 g/mol (formula C17H23N9O5).

Related peptides

Build on Lutropin subunit beta data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key