Islet amyloid polypeptide
experimentalAlso known as: Amylin, Diabetes-associated peptide, Insulinoma amyloid peptide, IAPP, P10997
**Mechanism of Action** Islet amyloid polypeptide (IAPP, amylin) is a 37-amino-acid peptide hormone co-secreted with insulin from pancreatic β-cells. It acts centrally via the area postrema and nucleus tractus solitarii to suppress glucagon secretion, slow gastric emptying, and promote satiety, thereby contributing to postprandial glucose regulation. IAPP also modulates peripheral insulin sensitivity and energy expenditure through interactions with calcitonin receptor-like receptors (CT-RAMP1/3). In pathological states, IAPP misfolds into toxic oligomers and amyloid fibrils, inducing β-cell apoptosis and contributing to islet dysfunction in type 2 diabetes. **Key Research Findings** Experimental studies demonstrate that IAPP aggregation is linked to β-cell loss and insulin resistance. Transgenic rodent models overexpressing human IAPP develop hyperglycemia and islet amyloid deposits, recapitulating features of type 2 diabetes. Conversely, IAPP receptor agonists (e.g., pramlintide) improve glycemic control by delaying gastric emptying and reducing postprandial glucagon. Research also implicates IAPP in energy homeostasis via hypothalamic signaling, with potential roles in obesity and metabolic syndrome. Current investigations focus on inhibitors of IAPP aggregation (e.g., small molecules, peptides) to preserve β-cell mass. **Clinical Relevance** Synthetic IAPP analogs (e.g., pramlintide) are FDA-approved as adjunctive therapy for type 1 and type 2 diabetes to improve postprandial glucose control. However, native IAPP’s amyloidogenic properties limit its therapeutic use. Experimental strategies targeting IAPP aggregation or receptor modulation are under preclinical evaluation for diabetes and obesity. No approved therapies directly address IAPP-mediated β-cell toxicity. For research purposes only — not medical advice.
Key data
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPLC165H261N51O55S2Mechanism of action
Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. IAPP function is mediated by the CALCR-RAMPs (AMYRs) receptor complexes (By similarity). Amylin can also bind CALCR receptor in the absence of RAMPs, although it is more selective for AMYRs (By similarity)
Research & studies
Frequently asked questions
What is Islet amyloid polypeptide?
**Mechanism of Action** Islet amyloid polypeptide (IAPP, amylin) is a 37-amino-acid peptide hormone co-secreted with insulin from pancreatic β-cells. It acts centrally via the area postrema and nucleus tractus solitarii to suppress glucagon secretion, slow gastric emptying, and promote satiety, thereby contributing to
How does Islet amyloid polypeptide work?
Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. IAPP function is mediated by the CALCR-RAMPs (AMYRs) receptor complexes (By similarity). Amylin can also bind CALCR rec
What is the research status of Islet amyloid polypeptide?
Islet amyloid polypeptide is currently classified as experimental, with 1,936 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Islet amyloid polypeptide?
Islet amyloid polypeptide has a molecular weight of approximately 3903.3 g/mol (formula C165H261N51O55S2).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Islet amyloid polypeptide data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key