Islet amyloid polypeptide

experimental

Also known as: Amylin, Diabetes-associated peptide, Insulinoma amyloid peptide, IAPP, P10997

**Mechanism of Action** Islet amyloid polypeptide (IAPP, amylin) is a 37-amino-acid peptide hormone co-secreted with insulin from pancreatic β-cells. It acts centrally via the area postrema and nucleus tractus solitarii to suppress glucagon secretion, slow gastric emptying, and promote satiety, thereby contributing to postprandial glucose regulation. IAPP also modulates peripheral insulin sensitivity and energy expenditure through interactions with calcitonin receptor-like receptors (CT-RAMP1/3). In pathological states, IAPP misfolds into toxic oligomers and amyloid fibrils, inducing β-cell apoptosis and contributing to islet dysfunction in type 2 diabetes. **Key Research Findings** Experimental studies demonstrate that IAPP aggregation is linked to β-cell loss and insulin resistance. Transgenic rodent models overexpressing human IAPP develop hyperglycemia and islet amyloid deposits, recapitulating features of type 2 diabetes. Conversely, IAPP receptor agonists (e.g., pramlintide) improve glycemic control by delaying gastric emptying and reducing postprandial glucagon. Research also implicates IAPP in energy homeostasis via hypothalamic signaling, with potential roles in obesity and metabolic syndrome. Current investigations focus on inhibitors of IAPP aggregation (e.g., small molecules, peptides) to preserve β-cell mass. **Clinical Relevance** Synthetic IAPP analogs (e.g., pramlintide) are FDA-approved as adjunctive therapy for type 1 and type 2 diabetes to improve postprandial glucose control. However, native IAPP’s amyloidogenic properties limit its therapeutic use. Experimental strategies targeting IAPP aggregation or receptor modulation are under preclinical evaluation for diabetes and obesity. No approved therapies directly address IAPP-mediated β-cell toxicity. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
Molecular weight
3903.3 g/mol
Molecular formula
C165H261N51O55S2
CAS number
122384-88-7
Research status
experimental
References
1,936
Tags
uniprot, 3d-structure, amidation, amyloid, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, disulfide-bond, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. IAPP function is mediated by the CALCR-RAMPs (AMYRs) receptor complexes (By similarity). Amylin can also bind CALCR receptor in the absence of RAMPs, although it is more selective for AMYRs (By similarity)

Research & studies

Inhibition of YIPF2 Improves the Vulnerability of Oligodendrocytes to Human Islet Amyloid Polypeptide
Neuroscience bulletin · 2024 · PubMed
Human islet amyloid polypeptide-induced β-cell cytotoxicity is linked to formation of α-sheet structure
Protein science : a publication of the Protein Society · 2024 · PubMed
A pancreatic player in dementia: pathological role for islet amyloid polypeptide accumulation in the brain
Neural regeneration research · 2023 · PubMed
Is islet amyloid polypeptide indeed expressed in the human brain?
Neuropathology and applied neurobiology · 2023 · PubMed
Islet amyloid polypeptide triggers α-synuclein pathology in Parkinson's disease
Progress in neurobiology · 2023 · PubMed
Islet amyloid polypeptide does not suppress pancreatic cancer
Molecular metabolism · 2023 · PubMed
Studies on alpha-synuclein and islet amyloid polypeptide interaction
Frontiers in molecular biosciences · 2023 · PubMed
Islet amyloid polypeptide cross-seeds tau and drives the neurofibrillary pathology in Alzheimer's disease
Molecular neurodegeneration · 2022 · PubMed

Frequently asked questions

What is Islet amyloid polypeptide?

**Mechanism of Action** Islet amyloid polypeptide (IAPP, amylin) is a 37-amino-acid peptide hormone co-secreted with insulin from pancreatic β-cells. It acts centrally via the area postrema and nucleus tractus solitarii to suppress glucagon secretion, slow gastric emptying, and promote satiety, thereby contributing to

How does Islet amyloid polypeptide work?

Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis (PubMed:2690069). Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. IAPP function is mediated by the CALCR-RAMPs (AMYRs) receptor complexes (By similarity). Amylin can also bind CALCR rec

What is the research status of Islet amyloid polypeptide?

Islet amyloid polypeptide is currently classified as experimental, with 1,936 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Islet amyloid polypeptide?

Islet amyloid polypeptide has a molecular weight of approximately 3903.3 g/mol (formula C165H261N51O55S2).

Related peptides

Build on Islet amyloid polypeptide data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key