Insulin-like peptide INSL5

experimental

Also known as: INSL5, Q9Y5Q6

Insulin-like peptide 5 (INSL5) is a member of the relaxin/insulin superfamily, encoded by the *INSL5* gene (UniProt Q9Y5Q6). Its proposed mechanism of action involves binding to the relaxin family peptide receptor 4 (RXFP4), a G-protein-coupled receptor expressed in the gastrointestinal tract and thymus. Activation of RXFP4 is thought to modulate smooth muscle contractility and may influence thymic epithelial cell development or immune regulation, though the precise downstream signaling pathways remain incompletely characterized. Current research on INSL5 is limited to experimental models, with no peer-reviewed human studies identified in PubMed. Preliminary findings suggest a role in regulating colonic motility and appetite, as well as potential involvement in thymic T-cell maturation. However, these observations are derived from in vitro or animal studies, and the peptide's physiological significance in humans has not been established. Given the absence of clinical data, INSL5 has no validated therapeutic applications. Its experimental status underscores the need for further investigation into its receptor interactions, tissue-specific functions, and potential relevance to gastrointestinal or immune disorders. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
Molecular weight
15333 g/mol
Research status
experimental
Tags
uniprot, 3d-structure, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, disulfide-bond, hormone, proteomics-identification, pyrrolidone-carboxylic-acid, reference-proteome, secreted, signal

Mechanism of action

May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor

Frequently asked questions

What is Insulin-like peptide INSL5?

Insulin-like peptide 5 (INSL5) is a member of the relaxin/insulin superfamily, encoded by the *INSL5* gene (UniProt Q9Y5Q6). Its proposed mechanism of action involves binding to the relaxin family peptide receptor 4 (RXFP4), a G-protein-coupled receptor expressed in the gastrointestinal tract and thymus. Activation of

How does Insulin-like peptide INSL5 work?

May have a role in gut contractility or in thymic development and regulation. Activates RXFP4 with high potency and appears to be the endogenous ligand for this receptor

What is the research status of Insulin-like peptide INSL5?

Insulin-like peptide INSL5 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Insulin-like peptide INSL5?

Insulin-like peptide INSL5 has a molecular weight of approximately 15333 g/mol.

Related peptides

Build on Insulin-like peptide INSL5 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key