Insulin-like 3

experimental

Also known as: Leydig insulin-like peptide, Relaxin-like factor, INSL3, P51460

**Mechanism of Action** Insulin-like 3 (INSL3), also known as Leydig insulin-like peptide or relaxin-like factor, is a member of the insulin/relaxin superfamily primarily secreted by testicular Leydig cells. It exerts its effects by binding to the relaxin family peptide receptor 2 (RXFP2), a G-protein-coupled receptor. Activation of RXFP2 triggers downstream signaling pathways, including cAMP accumulation and MAPK/ERK activation, which mediate cellular responses. INSL3 is critical for testicular descent during fetal development, acting via the gubernaculum to facilitate transabdominal migration of the testes. In adults, it is implicated in paracrine regulation of testicular function, including modulation of germ cell survival and steroidogenesis. **Key Research Findings** Preclinical studies demonstrate that INSL3 knockout mice exhibit bilateral cryptorchidism and impaired spermatogenesis, confirming its essential role in testicular descent. In humans, mutations in the *INSL3* or *RXFP2* genes are associated with cryptorchidism, a common congenital anomaly. Experimental research also suggests INSL3 may influence bone metabolism, as RXFP2 is expressed in osteoblasts, and INSL3-deficient mice show reduced bone mass. Additionally, circulating INSL3 levels correlate with Leydig cell function and decline with age, making it a potential biomarker for male reproductive aging. However, its therapeutic applications remain experimental, with no approved clinical uses. **Clinical Relevance** INSL3 has potential diagnostic value for assessing Leydig cell function in conditions such as hypogonadism, cryptorchidism, and infertility. Experimental studies are exploring its role in bone health and as a target for male contraceptive development. However, clinical translation is limited by the need for further validation of its systemic effects and safety profile. Current evidence is derived from animal models and small human studies, with no established therapeutic indications. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
Molecular weight
14502 g/mol
Research status
experimental
References
120
Tags
uniprot, 3d-structure, alternative-splicing, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, disease-variant, disulfide-bond, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor

Research & studies

Clinical Implications of Minipuberty
The New England journal of medicine · 2026 · PubMed
New Insights into the Role of INSL-3 in the Development of Cryptorchidism
Children (Basel, Switzerland) · 2023 · PubMed
Insulin-like 3 affects zebrafish spermatogenic cells directly and via Sertoli cells
Communications biology · 2021 · PubMed

Insl3 receptors Rxfp2a and 2b are expressed by type A spermatogonia and Sertoli/myoid cells, respectively.; Loss of insl3 increases germ cell apoptosis in males starting at 9 months of age.; Insl3 upregulates retinoic acid signaling and downregulates Pparg signaling in the testis.; Insl3 recruits retinoic acid and Pparg pathways to mediate Fsh stimulation of spermatogenesis.

Diverse functions of insulin-like 3 peptide
The Journal of endocrinology · 2020 · PubMed

INSL3 is the only known physiological ligand of the G protein-coupled receptor RXFP2.; The INSL3/RXFP2 system is crucial for testicular descent and male reproductive health.; INSL3 deletion affects antral follicle development and uterine function in females.; INSL3/RXFP2 functions have been identified in skeletal muscle, bone, kidney, thyroid, brain, and eye.

Correlation between insulin-like peptide 3 and appendix testis length in congenital cryptorchidism
Journal of paediatrics and child health · 2020 · PubMed
Novel combined insulin-like 3 variations of a single nucleotide in cryptorchidism
Journal of pediatric endocrinology & metabolism : JPEM · 2019 · PubMed
Genetic analysis of the human insulin-like 3 gene in pediatric patients with testicular torsion
Pediatric surgery international · 2018 · PubMed
Insulin-like 3 expression and fibrosis induction after intra-testicular injection of magnetic nanoparticles in rat testis and the ameliorative role of Echinacea purpurea extract
Biotechnic & histochemistry : official publication of the Biological Stain Commission · 2018 · PubMed

Frequently asked questions

What is Insulin-like 3?

**Mechanism of Action** Insulin-like 3 (INSL3), also known as Leydig insulin-like peptide or relaxin-like factor, is a member of the insulin/relaxin superfamily primarily secreted by testicular Leydig cells. It exerts its effects by binding to the relaxin family peptide receptor 2 (RXFP2), a G-protein-coupled receptor.

How does Insulin-like 3 work?

Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor

What is the research status of Insulin-like 3?

Insulin-like 3 is currently classified as experimental, with 120 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Insulin-like 3?

Insulin-like 3 has a molecular weight of approximately 14502 g/mol.

Related peptides

Build on Insulin-like 3 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key