Hypocretin neuropeptide precursor

experimental

Also known as: Hypocretin, Orexin precursor, Prepro-orexin, Preprohypocretin, HCRT, O43612

The hypocretin neuropeptide precursor (prepro-orexin) is a 131-amino acid polypeptide encoded by the *HCRT* gene, which is proteolytically processed into two mature neuropeptides: hypocretin-1 (orexin-A) and hypocretin-2 (orexin-B). These peptides act primarily via two G-protein-coupled receptors, OX1R and OX2R, which are expressed in the hypothalamus and other brain regions. Hypocretins are critical for stabilizing wakefulness and promoting arousal, while also modulating feeding behavior, energy homeostasis, and reward processing. The mechanism involves excitatory signaling that coordinates the transition between sleep and wake states, with hypocretin neurons projecting to monoaminergic and cholinergic arousal centers. Key research findings indicate that loss of hypocretin-producing neurons in the lateral hypothalamus is a primary cause of narcolepsy type 1 in humans and animal models. Experimental studies have demonstrated that hypocretin administration promotes wakefulness and suppresses rapid eye movement (REM) sleep, while hypocretin receptor antagonists (e.g., suvorexant) are used clinically for insomnia. Additionally, hypocretin signaling influences appetite and energy expenditure, with dysregulation linked to obesity and metabolic disorders. Current research explores hypocretin-based therapies for narcolepsy, sleep disorders, and potentially for conditions involving arousal dysregulation. Clinically, hypocretin deficiency is a diagnostic biomarker for narcolepsy type 1, and hypocretin receptor agonists are under investigation for treating hypersomnia. However, the precursor itself remains experimental, with limited translational applications due to its short half-life and challenges in central nervous system delivery. Further studies are needed to clarify its role in comorbid conditions such as depression, addiction, and neurodegenerative diseases. For research purposes only — not medical advice.

Key data

Category
Cognitive & Neuroprotective
Sequence
MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI
Molecular weight
13363 g/mol
Research status
experimental
References
9
Tags
uniprot, 3d-structure, amidation, cleavage-on-pair-of-basic-residues, cytoplasmic-vesicle, disease-variant, disulfide-bond, endoplasmic-reticulum, neuropeptide, proteomics-identification, pyrrolidone-carboxylic-acid, reference-proteome

Mechanism of action

Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested

Research & studies

The role of the hypothalamus-gut microbiota in the pathogenesis of periparturient fatty liver disease in dairy cows
Veterinary journal (London, England : 1997) · 2025 · PubMed
Increased Expression of Orexin-A in Patients Affected by Polycystic Kidney Disease
International journal of molecular sciences · 2024 · PubMed

ADPKD patients had significantly higher serum orexin-A levels (477.07 pg/mL) compared to controls (321.49 pg/mL).; Orexin-A inversely correlated with systolic blood pressure in ADPKD patients.; Orexin-A directly correlated with eGFR in ADPKD patients.; No association was found between analyzed SNPs and orexin-A levels in ADPKD.

Exploratory Transcriptomic Profiling Reveals the Role of Gut Microbiota in Vascular Dementia
International journal of molecular sciences · 2023 · PubMed
Microarray profiling of hypothalamic gene expression changes in Huntington's disease mouse models
Frontiers in neuroscience · 2022 · PubMed
Changes in gene expression in brain structures related to visceral sensation, autonomic functions, food intake, and cognition in melanoma-bearing mice
The European journal of neuroscience · 2020 · PubMed
The neuropeptide genes SST, TAC1, HCRT, NPY, and GAL are powerful epigenetic biomarkers in head and neck cancer: a site-specific analysis
Clinical epigenetics · 2018 · PubMed
Association between Single Nucleotide Polymorphisms in Gamma-Aminobutyric Acid B Receptor, Insulin Receptor Substrate-1, and Hypocretin Neuropeptide Precursor Genes and Susceptibility to Obstructive Sleep Apnea Hypopnea Syndrome in a Chinese Han Population
Medical principles and practice : international journal of the Kuwait University, Health Science Centre · 2016 · PubMed

rs29230 genotype and allele frequencies differed significantly between cases and controls (p=0.0205 and p=0.0191; OR=0.493).; rs29230 showed significant differences in male patients and overweight subgroup (p=0.0259 and p=0.0333, respectively).; rs1801278 allele and genotype frequencies were significantly different between cases and controls (p=0.0488 and p=0.0471).; No significant association was found between rs9902709 and OSAHS risk (p=0.2762).

Identification of differentially expressed genes in hypothalamus of chicken during cold stress
Molecular biology reports · 2014 · PubMed

Frequently asked questions

What is Hypocretin neuropeptide precursor?

The hypocretin neuropeptide precursor (prepro-orexin) is a 131-amino acid polypeptide encoded by the *HCRT* gene, which is proteolytically processed into two mature neuropeptides: hypocretin-1 (orexin-A) and hypocretin-2 (orexin-B). These peptides act primarily via two G-protein-coupled receptors, OX1R and OX2R, which

How does Hypocretin neuropeptide precursor work?

Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested

What is the research status of Hypocretin neuropeptide precursor?

Hypocretin neuropeptide precursor is currently classified as experimental, with 9 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Hypocretin neuropeptide precursor?

Hypocretin neuropeptide precursor has a molecular weight of approximately 13363 g/mol.

Related peptides

Build on Hypocretin neuropeptide precursor data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key