Glycoprotein hormone alpha-2

experimental

Also known as: Putative secreted protein Zsig51, Thyrostimulin subunit alpha, GPHA2, Q96T91

Glycoprotein hormone alpha-2 (GPHA2), also known as thyrostimulin subunit alpha, forms a heterodimer with glycoprotein hormone beta-5 (GPHB5) to create thyrostimulin, a non-classical glycoprotein hormone. Its primary mechanism of action involves binding to and activating the thyroid-stimulating hormone receptor (TSHR), which is canonically associated with thyroid function. This activation stimulates intracellular cyclic AMP (cAMP) production via G-protein-coupled receptor signaling, mirroring the downstream effects of thyroid-stimulating hormone (TSH) but with distinct tissue distribution and regulatory properties. Current research on GPHA2 remains at an experimental stage, with limited published studies (2 PubMed references). Key findings indicate that thyrostimulin exhibits higher potency than TSH at the TSHR in vitro, suggesting a potential role in fine-tuning thyroid hormone regulation or acting in tissues where TSHR is expressed outside the thyroid, such as the pituitary or gonads. However, the physiological significance of GPHA2 in vivo is not fully characterized, and its expression patterns and functional redundancy with TSH require further investigation. Clinically, GPHA2's relevance is speculative but may involve conditions of thyroid dysfunction, such as resistance to TSH or atypical hyperthyroidism, where thyrostimulin could contribute to aberrant TSHR activation. Its potential as a therapeutic target or biomarker remains unexplored due to the scarcity of data. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
Molecular weight
14163 g/mol
Research status
experimental
References
2
Tags
uniprot, disulfide-bond, glycoprotein, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production (PubMed:12045258). Plays a central role in controlling thyroid cell metabolism (PubMed:12045258)

Research & studies

Oral Supplementation of Indole-3-acetic Acid Alleviates High-Fat-Induced Obesity by Activating the Gpha2-Mediated Thyroid-Stimulating Hormone Pathway
Journal of agricultural and food chemistry · 2025 · PubMed

Oral IAA dose-dependently attenuated weight gain, adiposity, hepatic steatosis, and dyslipidemia in obese mice.; Intraperitoneal IAA (50 mg/kg/day) paradoxically increased weight gain.; Oral IAA enriched beneficial gut genera (Ileibacterium, Anaerotignum, Clostridium) and boosted SCFA (acetate, butyrate) production.; IAA upregulated hepatic Gpha2, activating the TSH-THR-PGC-1α-PPAR cascade and repressing lipogenic genes (Fasn, Acaca, Srebp-1c).

A glycoprotein hormone expressed in corticotrophs exhibits unique binding properties on thyroid-stimulating hormone receptor
Molecular endocrinology (Baltimore, Md.) · 2006 · PubMed

CGH subunits GPHA2 and GPHB5 are expressed in human anterior pituitary corticotrophs, skin, retina, and testis.; CGH binds to TSHR with high affinity and saturability, and competition studies reveal a binding site that interacts only with CGH, not TSH.; Transgenic overexpression of GPHB5 in mice increases serum T4, reduces body weight, and causes proptosis.; In vivo CGH administration dose-dependently elevates T4 and induces hypertrophy of inner adrenal cortex cells.

Frequently asked questions

What is Glycoprotein hormone alpha-2?

Glycoprotein hormone alpha-2 (GPHA2), also known as thyrostimulin subunit alpha, forms a heterodimer with glycoprotein hormone beta-5 (GPHB5) to create thyrostimulin, a non-classical glycoprotein hormone. Its primary mechanism of action involves binding to and activating the thyroid-stimulating hormone receptor (TSHR),

How does Glycoprotein hormone alpha-2 work?

Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production (PubMed:12045258). Plays a central role in controlling thyroid cell metabolism (PubMed:12045258)

What is the research status of Glycoprotein hormone alpha-2?

Glycoprotein hormone alpha-2 is currently classified as experimental, with 2 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Glycoprotein hormone alpha-2?

Glycoprotein hormone alpha-2 has a molecular weight of approximately 14163 g/mol.

Related peptides

Build on Glycoprotein hormone alpha-2 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key