Cortistatin

experimental

Also known as: CORT, O00230

Cortistatin is a neuropeptide structurally related to somatostatin, encoded by the *CORT* gene (UniProt O00230). Its mechanism of action involves binding to all five somatostatin receptor subtypes (SSTR1–5) with high affinity, similar to somatostatin, but it also exhibits distinct properties, including binding to the ghrelin receptor (GHS-R1a) and the Mas-related G protein-coupled receptor MRGPRX2. This dual receptor interaction enables cortistatin to modulate neurotransmission, immune responses, and endocrine signaling, with effects on sleep regulation, inflammation, and cell proliferation. Key research findings indicate that cortistatin promotes slow-wave sleep, reduces inflammatory cytokine release (e.g., TNF-α, IL-6) in macrophages, and exhibits neuroprotective effects in models of neurodegeneration. Preclinical studies have shown its ability to inhibit tumor cell growth in certain cancers, though results vary by cell type. Its anti-inflammatory and immunomodulatory properties are distinct from somatostatin, suggesting unique therapeutic potential, but human data remain limited. Clinically, cortistatin is in the experimental stage, with no approved indications. Its potential applications include treating inflammatory disorders (e.g., rheumatoid arthritis, sepsis), sleep disturbances, and neurological conditions. However, challenges such as short half-life and lack of selective analogs hinder translation. Further research is needed to clarify its receptor-specific effects and safety profile. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Molecular weight
1721 g/mol
Molecular formula
C81H113N19O19S2
CAS number
193829-96-8
Research status
experimental
References
362
Tags
uniprot, 3d-structure, cleavage-on-pair-of-basic-residues, disulfide-bond, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Precursor of neuropeptides that bind to all somatostatin receptor (SSTR) subtypes (PubMed:9125122). Inhibits cAMP production induced by forskolin through SSTRs (PubMed:9125122)

Research & studies

Assessing the diagnostic, prognostic, and therapeutic potential of the somatostatin/cortistatin system in glioblastoma
Cellular and molecular life sciences : CMLS · 2025 · PubMed
An SSTR2-somatostatin chemotactic axis drives T cell progenitor homing to the intestines
Nature immunology · 2025 · PubMed
CDK8/19 inhibition triggers a switch from mitosis to endomitosis in cord blood megakaryocytes
British journal of haematology · 2024 · PubMed
Cortistatin exerts an immunomodulatory and neuroprotective role in a preclinical model of ischemic stroke
Pharmacological research · 2024 · PubMed
Acid-responsive CST@NPs enhanced diabetic wound healing through rescuing mitochondrial dysfunction
Bioactive materials · 2024 · PubMed
Nanoarchitectonics of Injectable Biomimetic Conjugates for Cartilage Protection and Therapy Based on Degenerative Osteoarthritis Progression
Biomaterials research · 2024 · PubMed
Cortistatin protects against septic cardiomyopathy by inhibiting cardiomyocyte pyroptosis through the SSTR2-AMPK-NLRP3 pathway
International immunopharmacology · 2024 · PubMed
Cortistatin prevents glucocorticoid-associated osteonecrosis of the femoral head via the GHSR1a/Akt pathway
Communications biology · 2024 · PubMed

CST expression was lower in ONFH patients compared to femoral neck fracture patients.; CST treatment improved bone quality and reduced ONFH phenotypes in a glucocorticoid-induced rat model.; CST reversed dexamethasone-induced metabolic disorder in osteoblasts and suppressed tube formation in endothelial cells.; Blocking GHSR1a or AKT signaling abolished CST's protective effects, indicating pathway dependence.

Frequently asked questions

What is Cortistatin?

Cortistatin is a neuropeptide structurally related to somatostatin, encoded by the *CORT* gene (UniProt O00230). Its mechanism of action involves binding to all five somatostatin receptor subtypes (SSTR1–5) with high affinity, similar to somatostatin, but it also exhibits distinct properties, including binding to the g

How does Cortistatin work?

Precursor of neuropeptides that bind to all somatostatin receptor (SSTR) subtypes (PubMed:9125122). Inhibits cAMP production induced by forskolin through SSTRs (PubMed:9125122)

What is the research status of Cortistatin?

Cortistatin is currently classified as experimental, with 362 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Cortistatin?

Cortistatin has a molecular weight of approximately 1721 g/mol (formula C81H113N19O19S2).

Related peptides

Build on Cortistatin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key
    Cortistatin — Mechanism, Research & Data | Peptides API