Cortistatin
experimentalAlso known as: CORT, O00230
Cortistatin is a neuropeptide structurally related to somatostatin, encoded by the *CORT* gene (UniProt O00230). Its mechanism of action involves binding to all five somatostatin receptor subtypes (SSTR1–5) with high affinity, similar to somatostatin, but it also exhibits distinct properties, including binding to the ghrelin receptor (GHS-R1a) and the Mas-related G protein-coupled receptor MRGPRX2. This dual receptor interaction enables cortistatin to modulate neurotransmission, immune responses, and endocrine signaling, with effects on sleep regulation, inflammation, and cell proliferation. Key research findings indicate that cortistatin promotes slow-wave sleep, reduces inflammatory cytokine release (e.g., TNF-α, IL-6) in macrophages, and exhibits neuroprotective effects in models of neurodegeneration. Preclinical studies have shown its ability to inhibit tumor cell growth in certain cancers, though results vary by cell type. Its anti-inflammatory and immunomodulatory properties are distinct from somatostatin, suggesting unique therapeutic potential, but human data remain limited. Clinically, cortistatin is in the experimental stage, with no approved indications. Its potential applications include treating inflammatory disorders (e.g., rheumatoid arthritis, sepsis), sleep disturbances, and neurological conditions. However, challenges such as short half-life and lack of selective analogs hinder translation. Further research is needed to clarify its receptor-specific effects and safety profile. For research purposes only — not medical advice.
Key data
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCKC81H113N19O19S2Mechanism of action
Precursor of neuropeptides that bind to all somatostatin receptor (SSTR) subtypes (PubMed:9125122). Inhibits cAMP production induced by forskolin through SSTRs (PubMed:9125122)
Research & studies
CST expression was lower in ONFH patients compared to femoral neck fracture patients.; CST treatment improved bone quality and reduced ONFH phenotypes in a glucocorticoid-induced rat model.; CST reversed dexamethasone-induced metabolic disorder in osteoblasts and suppressed tube formation in endothelial cells.; Blocking GHSR1a or AKT signaling abolished CST's protective effects, indicating pathway dependence.
Frequently asked questions
What is Cortistatin?
Cortistatin is a neuropeptide structurally related to somatostatin, encoded by the *CORT* gene (UniProt O00230). Its mechanism of action involves binding to all five somatostatin receptor subtypes (SSTR1–5) with high affinity, similar to somatostatin, but it also exhibits distinct properties, including binding to the g
How does Cortistatin work?
Precursor of neuropeptides that bind to all somatostatin receptor (SSTR) subtypes (PubMed:9125122). Inhibits cAMP production induced by forskolin through SSTRs (PubMed:9125122)
What is the research status of Cortistatin?
Cortistatin is currently classified as experimental, with 362 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Cortistatin?
Cortistatin has a molecular weight of approximately 1721 g/mol (formula C81H113N19O19S2).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on Cortistatin data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key