Calcitonin gene-related peptide 2

experimental

Also known as: Beta-type CGRP, Calcitonin gene-related peptide II, CALCB, P10092

Calcitonin gene-related peptide 2 (CGRP2, also known as beta-type CGRP) is a 37-amino-acid peptide encoded by the *CALCB* gene. Its primary mechanism of action involves binding to the calcitonin receptor-like receptor (CALCRL) in complex with receptor activity-modifying protein 1 (RAMP1), forming a functional CGRP receptor. Activation of this receptor complex stimulates adenylate cyclase, increasing intracellular cyclic AMP levels, which leads to potent vasodilation, particularly in cerebral and peripheral vasculature. CGRP2 is structurally similar to alpha-CGRP but differs by three amino acids, and it is predominantly expressed in sensory neurons and the enteric nervous system. As of the current research status (EXPERIMENTAL), no peer-reviewed studies specifically investigating CGRP2 are indexed in PubMed. Available knowledge is extrapolated from studies on alpha-CGRP, given their shared receptor pharmacology. Key findings from related CGRP research indicate roles in migraine pathophysiology, neurogenic inflammation, and cardiovascular regulation. CGRP2 may contribute to nociceptive signaling and vascular tone modulation, but direct experimental evidence remains absent. Clinical relevance is speculative at this stage. CGRP2 could be a target for migraine therapeutics or cardiovascular conditions involving vasodilation, but no clinical trials or translational studies have been conducted. The lack of specific research limits any definitive conclusions about its therapeutic potential or safety profile. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Molecular weight
127.21 g/mol
Molecular formula
C6H9NS
CAS number
59311-67-0
Research status
experimental
Tags
uniprot, amidation, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, disulfide-bond, hormone, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

CALCB/CGRP2 is a peptide hormone that induces vasodilation mediated by the CALCRL-RAMP1 receptor complex (PubMed:1318039, PubMed:9620797). Dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role (PubMed:3492492)

Frequently asked questions

What is Calcitonin gene-related peptide 2?

Calcitonin gene-related peptide 2 (CGRP2, also known as beta-type CGRP) is a 37-amino-acid peptide encoded by the *CALCB* gene. Its primary mechanism of action involves binding to the calcitonin receptor-like receptor (CALCRL) in complex with receptor activity-modifying protein 1 (RAMP1), forming a functional CGRP rece

How does Calcitonin gene-related peptide 2 work?

CALCB/CGRP2 is a peptide hormone that induces vasodilation mediated by the CALCRL-RAMP1 receptor complex (PubMed:1318039, PubMed:9620797). Dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role (PubMed:3492492)

What is the research status of Calcitonin gene-related peptide 2?

Calcitonin gene-related peptide 2 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Calcitonin gene-related peptide 2?

Calcitonin gene-related peptide 2 has a molecular weight of approximately 127.21 g/mol (formula C6H9NS).

Related peptides

Build on Calcitonin gene-related peptide 2 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key