C-type natriuretic peptide
approvedAlso known as: NPPC, P23582
**Mechanism of Action** C-type natriuretic peptide (CNP), encoded by the *NPPC* gene, is a paracrine hormone primarily expressed in the central nervous system, vascular endothelium, and bone. It exerts its effects by binding to natriuretic peptide receptor-B (NPR-B), a guanylyl cyclase-coupled receptor, leading to increased intracellular cyclic guanosine monophosphate (cGMP). In the skeletal system, CNP regulates endochondral ossification by promoting the proliferation and differentiation of chondrocytes in the cartilaginous growth plate, thereby modulating longitudinal bone growth. Unlike atrial and B-type natriuretic peptides, CNP has minimal natriuretic or vasodilatory activity. **Key Research Findings** Approved for clinical use, CNP analogs (e.g., vosoritide) have demonstrated efficacy in increasing growth velocity in children with achondroplasia, the most common form of dwarfism caused by activating mutations in fibroblast growth factor receptor 3 (FGFR3). Preclinical studies show that CNP counteracts FGFR3-mediated inhibition of chondrocyte proliferation via cGMP-dependent pathways. Clinical trials have confirmed sustained improvements in annualized growth rate without significant adverse effects on bone quality or metabolic parameters. Research also indicates CNP’s role in vascular remodeling and reproductive function, though these applications remain investigational. **Clinical Relevance** CNP-based therapies represent the first targeted pharmacological intervention for achondroplasia, addressing the underlying growth plate pathology rather than symptomatic management. Vosoritide, a recombinant CNP analog with extended half-life, is approved for pediatric patients with achondroplasia. Ongoing studies explore its utility in other skeletal dysplasias and conditions involving impaired endochondral ossification. CNP’s limited systemic hemodynamic effects make it a safer alternative to other natriuretic peptides for chronic use. For research purposes only — not medical advice.
Key data
MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGCC93H157N27O28S3Mechanism of action
Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic (PubMed:1672777). Acts by specifically binding and stimulating NPR2 to produce cGMP (PubMed:1672777, PubMed:21098034). Binds the clearance receptor NPR3 (PubMed:11533490)
Research & studies
CNP functions locally in an autocrine or paracrine manner, unlike the endocrine ANP and BNP.; CNP regulates cardiovascular processes as well as bone growth, gamete maturation, auditory processing, and neuronal integrity.; There is growing interest in therapeutic strategies that mimic CNP's biological activity across multiple organ systems.
Frequently asked questions
What is C-type natriuretic peptide?
**Mechanism of Action** C-type natriuretic peptide (CNP), encoded by the *NPPC* gene, is a paracrine hormone primarily expressed in the central nervous system, vascular endothelium, and bone. It exerts its effects by binding to natriuretic peptide receptor-B (NPR-B), a guanylyl cyclase-coupled receptor, leading to incr
How does C-type natriuretic peptide work?
Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic (PubMed:1672777). Acts by specifically binding and stimulating NPR2 to produce cGMP (PubMed:1672777, PubMed:21098034). Binds the clearance receptor NPR3 (PubMed:11533490)
What is the research status of C-type natriuretic peptide?
C-type natriuretic peptide is currently classified as approved, with 1,664 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of C-type natriuretic peptide?
C-type natriuretic peptide has a molecular weight of approximately 2197.6 g/mol (formula C93H157N27O28S3).
Related peptides
Insulin decreases blood glucose concentration.
Parathyroid hormone elevates calcium level by dissolving the salts in bone and preventing their renal excretion .
Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Nonapeptide posterior pituitary hormone driving uterine contraction and milk letdown; studied intranasally for social cognition.
The carboxylated form is one of the main organic components of the bone matrix, which constitutes 1-2% of the total bone protein .
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes.
Build on C-type natriuretic peptide data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key