Apelin

experimental

Also known as: APJ endogenous ligand, APLN, Q9ULZ1

**Mechanism of Action** Apelin, encoded by the *APLN* gene (UniProt Q9ULZ1), is an endogenous peptide hormone that acts as the primary ligand for the G protein-coupled apelin receptor (APJ). Binding to APJ activates multiple intracellular signaling cascades, including Gαi/o-mediated inhibition of cAMP production, β-arrestin recruitment, and downstream phosphorylation of ERK1/2 and Akt pathways. These signals modulate vascular tone, cardiac contractility, and fluid homeostasis, primarily through nitric oxide-dependent vasodilation and regulation of aquaporin expression in the kidney. **Key Research Findings** Preclinical studies demonstrate apelin’s potent positive inotropic effects in isolated cardiomyocytes and intact hearts, with improved cardiac output in models of heart failure. Apelin also reduces mean arterial pressure via endothelial nitric oxide synthase activation and enhances diuresis by antagonizing vasopressin. In metabolic studies, apelin improves insulin sensitivity and glucose uptake in skeletal muscle. However, its short plasma half-life (~5 minutes) limits translational utility, prompting development of stable analogs. Over 2,941 PubMed-indexed studies support its role in cardiovascular, metabolic, and fluid-regulatory systems. **Clinical Relevance** Apelin is under experimental investigation for heart failure, hypertension, and metabolic disorders. Phase I/II trials of long-acting apelin analogs (e.g., BMS-986224) show dose-dependent hemodynamic effects, including reduced afterload and increased cardiac index, with favorable safety profiles. No approved therapies currently exist, and further studies are needed to establish efficacy in chronic disease settings. For research purposes only — not medical advice.

Key data

Category
Hormonal & Endocrine
Sequence
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Molecular weight
6156 g/mol
Molecular formula
C266H427N95O71S2
CAS number
372170-33-7
Research status
experimental
References
2,941
Tags
uniprot, 3d-structure, angiogenesis, cleavage-on-pair-of-basic-residues, developmental-protein, gastrulation, hormone, host-virus-interaction, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Peptide hormone that functions as endogenous ligand for the G protein-coupled apelin receptor (APLNR/APJ), that plays a role in cadiovascular homeostasis (PubMed:10525157, PubMed:22810587, PubMed:35817871, PubMed:38428423). Functions as a balanced agonist activating both G(i) protein pathway and beta-arrestin pathway of APLNR (PubMed:22810587, PubMed:38428423). Downstream G proteins activation, apelin can inhibit cAMP production and activate key intracellular effectors such as ERKs (PubMed:22810587, PubMed:35817871, PubMed:38428423). On the other hand, APLNR activation induces beta-arrestin recruitment to the membrane leading to desensitization and internalization of the receptor (PubMed:22810587, PubMed:38428423). Apelin blunts cardiac hypertrophic induction from APLNR on response to pathological stimuli, but also induces myocardial hypertrophy under normal conditions (PubMed:22810587, PubMed:38428423). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Involved in the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis (By similarity). Has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking; the oral intake of apelin in the colostrum and the milk might therefore modulate immune responses in neonates (By similarity). Plays a role in early coronary blood vessels formation (By similarity). Mediates myocardial contractility in an ERK1/2-dependent manner (By similarity). May also have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior (By similarity)

Research & studies

The role of apelin in cancer
Frontiers in oncology · 2025 · PubMed
Apelin Alleviated Endothelial-To-Mesenchymal Transition via Increasing BKCa in Diabetic Nephropathy
FASEB journal : official publication of the Federation of American Societies for Experimental Biology · 2025 · PubMed
Repression of apelin Furin cleavage sites provides antimetastatic strategy in colorectal cancer
EMBO molecular medicine · 2025 · PubMed
Apelin deficiency exacerbates cardiac injury following infarction by accelerating cardiomyocyte ferroptosis
Free radical research · 2024 · PubMed
Neural progenitor-derived Apelin controls tip cell behavior and vascular patterning
Science advances · 2024 · PubMed

Apelin-expressing neural progenitor cells in the dorsal neural tube direct tip cell elongation and migration.; Neural, not vascular, Apelin restoration remedies angiogenic defects in apelin mutants.; Apelin signaling is required for tip cell filopodia formation and cell elongation.; Apelin signaling modulates PI3K and ERK signaling in tip cells in vivo.

Apelin regulates skeletal muscle adaptation to exercise in a high-intensity interval training model
American journal of physiology. Cell physiology · 2024 · PubMed
Targeting the apelin system for the treatment of cardiovascular diseases
Cardiovascular research · 2023 · PubMed

The apelin system opposes the renin-angiotensin and vasopressin systems.; Apelin receptor activation promotes endothelium-dependent vasodilation, inotropy, and lowers blood pressure.; The system protects against arrhythmias, inhibits thrombosis, and has anti-inflammatory and anti-fibrotic actions.; It promotes aqueous diuresis through direct and central effects in the kidney.

Therapeutic potential of apelin and Elabela in cardiovascular disease
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie · 2023 · PubMed

Apelin and Elabela promote vascular development and maintain myocardial cell homeostasis.; Apelin-APJ signaling is involved in myocardial infarction, ischemia-reperfusion injury, atherosclerosis, pulmonary arterial hypertension, preeclampsia, and congenital heart disease.; Research is ongoing to develop apelin, Ela, and their analogues for clinical cardiovascular treatments.; Literature on the therapeutic potential of APJ agonists in the cardiovascular system is still limited.

Frequently asked questions

What is Apelin?

**Mechanism of Action** Apelin, encoded by the *APLN* gene (UniProt Q9ULZ1), is an endogenous peptide hormone that acts as the primary ligand for the G protein-coupled apelin receptor (APJ). Binding to APJ activates multiple intracellular signaling cascades, including Gαi/o-mediated inhibition of cAMP production, β-arr

How does Apelin work?

Peptide hormone that functions as endogenous ligand for the G protein-coupled apelin receptor (APLNR/APJ), that plays a role in cadiovascular homeostasis (PubMed:10525157, PubMed:22810587, PubMed:35817871, PubMed:38428423). Functions as a balanced agonist activating both G(i) protein pathway and beta-arrestin pathway of APLNR (PubMed:22810587, PubMed:38428423). Downstream G proteins activation, ap

What is the research status of Apelin?

Apelin is currently classified as experimental, with 2,941 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Apelin?

Apelin has a molecular weight of approximately 6156 g/mol (formula C266H427N95O71S2).

Related peptides

Build on Apelin data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key